KEGG   Auricularia subglabra: AURDEDRAFT_109769Help
Entry
AURDEDRAFT_109769 CDS       T03129                                 

Definition
(GenBank) hypothetical protein
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
adl  Auricularia subglabra
Pathway
adl00260  Glycine, serine and threonine metabolism
adl01100  Metabolic pathways
adl01110  Biosynthesis of secondary metabolites
adl01130  Biosynthesis of antibiotics
adl01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:adl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AURDEDRAFT_109769
Enzymes [BR:adl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     AURDEDRAFT_109769
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 Aminotran_5 DegT_DnrJ_EryC1 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: EJD55442
JGI: 109769
AA seq 421 aa AA seqDB search
MDPSQVPQYISNHLAEPVGGTLESSRQKVAQEVKFDLLSATQADENAKKVHEITRSFISD
TVTVPTPEMYQYALQASLGDDVFDEPCTKLLEEHLARITGKEAAIFVPSGTMSNQLALRA
HLTQPPHSVLMDVRGHVNVHEAGGLAAHCGASTIPVTPANGHHITLSEVKENIKLDNELY
HTAVTRVISLENTLNGTIFPQEEIVAISEYAHSVGVLMHLDGARLWHVAAETGTPLRELC
APFDSVNMCFSKGLGAPIGSILVGSRPFIDRARWLRKMFGGGMRQTGFLAAAAAYALTNN
FPRLPAVHTLARRLEAGLQKLGVKITSPAETCMVFFDASHLGIPTTELVDRAENLPDPIL
IYGSRLCIHIQTSPQAVDDLLNLFEVLIEEKRKAGLIKDGSAATANGVPNGATPASPYVK
A
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atggacccgagccaggtaccccagtacatttcaaaccacctcgccgagcctgtgggcggc
acgctcgaatcctcgcgccagaaggtagcgcaggaagtcaagtttgacctactctctgcg
actcaggcagatgagaacgcgaagaaggtccatgagattactcgcagcttcatctcggac
acggtcactgtgcccacgccggaaatgtaccaatacgcgctgcaggcgtctctcggagac
gatgtcttcgacgagccttgcacgaagctgctcgaggagcatctggcgcgtataaccggc
aaggaggcagctatcttcgtgccttcggggaccatgtcgaatcagcttgctttgcgggca
catttgacacaaccgccgcacagcgtgctcatggacgtccggggacatgtcaacgtgcat
gaggccggcggtttggctgcgcactgcggcgcgtcgacgattcccgtcacgcctgcgaat
gggcaccacattacgctttctgaggtcaaggagaacatcaagctcgacaatgagttatac
catactgctgtgacccgtgtcatctcgctggagaacacgctaaatggcacgatctttcct
caagaggagatcgtcgcgatatcagaatacgcacactccgtcggcgtgctgatgcacctg
gacggcgcgcgactgtggcatgtcgccgcggagacaggcactccgctgcgcgagctctgc
gcgcccttcgactcggtcaacatgtgcttcagcaaagggctgggcgcgcccatcgggtcc
attctcgtcgggagccgtccgttcatcgaccgcgcgcgctggctgcgcaagatgtttggc
ggcggtatgcgccagacgggcttcctggccgcggccgcggcctacgcgctcacaaacaac
ttcccgcgcttgcccgccgtgcacacgctcgcgcgccggcttgaggcgggcctgcagaag
ctcggcgtcaagatcaccagtcccgcggagacgtgcatggtattcttcgacgccagccac
ctgggtatccccacgacggagctagtcgaccgcgcggagaacctgccagatccgatcctg
atctacggcagccgcctctgcatccacatccagacctccccgcaagcggtggacgacctg
ctcaacctcttcgaggtgctgatcgaggagaagcgcaaggctggcctcatcaaggatggt
tcggcagcgacggccaacggcgtcccaaatggcgcgacgccggcgtcgccgtacgtcaag
gcgtag

DBGET integrated database retrieval system