KEGG   Auricularia subglabra: AURDEDRAFT_111555Help
Entry
AURDEDRAFT_111555 CDS       T03129                                 

Definition
(GenBank) class II aaRS and biotin synthetase
  KO
K01942  biotin---protein ligase [EC:6.3.4.9 6.3.4.10 6.3.4.11 6.3.4.15]
Organism
adl  Auricularia subglabra
Pathway
adl00780  Biotin metabolism
adl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:adl00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    AURDEDRAFT_111555
Enzymes [BR:adl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.9  biotin---[methylmalonyl-CoA-carboxytransferase] ligase
     AURDEDRAFT_111555
    6.3.4.10  biotin---[propionyl-CoA-carboxylase (ATP-hydrolysing)] ligase
     AURDEDRAFT_111555
    6.3.4.11  biotin---[methylcrotonoyl-CoA-carboxylase] ligase
     AURDEDRAFT_111555
    6.3.4.15  biotin---[biotin carboxyl-carrier protein] ligase
     AURDEDRAFT_111555
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BPL_N BPL_LplA_LipB GATase_3 BPL_C Glyco_hydro_42M DJ-1_PfpI
Motif
Other DBs
NCBI-ProteinID: EJD52052
JGI: 111555
AA seq 683 aa AA seqDB search
MNVLVYNGQGVSQTSLAHTLSALRALTHPYLSVRTVSAATLAKQPWAPTCALLVLPGGRD
LPYLTALSEHIPSANDAIKSYVARGGRFLGICAGAYYASRAIQWENGRPGFEVSGERPLA
FYPGKSTGCTYPGFEYQSERGARIVRLALGDQDGAEPIDVYYNGGGEFVDADTLASEGVR
VVARYTQDDARGKVAAVSCRVGQGTALLWACHPEYPLVAEPCATVIAQGRDYELGLSAEK
LAAAESRRWAFLRASLTQLGIRVGEPTAPLVPSAPLPYILSSASDAYTTRVSDALRPLLN
ENGLLRDRHNAVHFQKPASSAQLAALIEDARSNPNPLPATPAEDRSAEDEDKIPVYIAAS
NLDQIRDEHTPCFSVQRYFKSLATQRGSNTSSGTWGLGDVLLYSEAVESTQTLLDKNPTF
CAALPAPLVALATHQLAGRGRGGNTWVSPRGSLMFSALLRVPLSALPAQRLALVQYLFSI
AVVEACRAVLPDDARSTVRIKWPNDIYAAPEEGDVFDPKVTRKLGGVLVSTNFRGGEVDL
IIGSGLNVLNDLPTTSLVSLAPNASALRETLRIEDLAASLLTRFDVLFAEFVATRGSFEP
FMERYMRYWLHSDQEVMLTTTDPPTRVRIVGLSPEYGLLRTVPVDRVVGPESSNPFARDA
GYIDLQPDGNSFDMFAGLIRVKG
NT seq 2054 nt NT seq  +upstreamnt  +downstreamnt
ggatgaacgtcctcgtctacaacggccagggcgtctcacagacctccctcgcccacaccc
tgtcggccctgcgtgcactgacgcacccgtacctgtccgtgcgcacagtcagcgccgcga
cactcgcaaagcagccctgggcgccgacatgcgcgctgctcgtgctccccggcggccgtg
atcttccctatctcaccgcactctcggagcacattcccagcgcgaacgacgccattaaga
gctatgtcgcgcgcggcggccgcttcctcggcatttgcgcgggcgcgtactacgcatcgc
gcgccatccagtgggagaacggacggcccggcttcgaggtttctggcgaacgcccgctcg
cgttctaccctggtaaaagcacgggttgcacttaccccggatttgagtaccagtccgagc
gcggcgcgcgcattgtgcggctcgcgcttggagaccaggacggcgcggaacccatcgatg
tgtactacaacggcggcggcgagttcgtcgatgcggatacgcttgcttcagagggtgtac
gcgtcgtcgcgcgatatacgcaggatgatgcgcggggaaaggtggccgccgtttcgtgcc
gcgtcggccaggggaccgcgctcctctgggcgtgtcacccggaatatcctctcgtcgcgg
agccctgtgcaaccgtcatcgctcagggacgcgactacgaacttggcctatccgccgaga
agctcgcggcggcggagtcgcgccgctgggcgtttctccgcgcgtcgctcacgcagctgg
gtatccgcgtcggcgagcctaccgcaccgctcgtgcccagtgcgccgctgccttatatcc
tttcttccgcgtcggacgcgtatacgacacgcgtttcagacgcgctccggccgctgctca
atgagaatggcttgttgcgcgacagacacaacgccgttcactttcaaaagccggcctcat
cggcgcaacttgcggcgctgatcgaagacgcgcgctcaaatcctaacccgcttcctgcga
cgcctgctgaggacaggtctgccgaggacgaggataagataccagtctacatcgcagcgt
cgaatctcgaccagatccgcgacgagcacacgccgtgcttcagcgtccagcgctacttca
agtcgctcgccacacagcggggcagcaacacctccagcggcacctgggggctcggcgacg
tcctactgtacagtgaagcagttgagagcacgcagacgctgctggataaaaacccaacct
tctgcgcagcgcttcctgcacccctcgtcgcgctcgcaacgcaccagctcgccggccgcg
ggcgcggtggcaacacgtgggtctccccgcgcggctcgctgatgttttccgcgctgctgc
gcgtccccctgagcgcacttccagcgcaaagactcgcgcttgtgcagtacctgttcagca
ttgccgtcgtcgaggcctgccgcgctgtcctccccgacgatgcaaggagcacggtcagga
tcaagtggccgaacgatatctacgctgcacctgaggagggggatgtcttcgatcctaagg
tcacgcgcaagctgggcggcgtgctcgtcagcacgaatttcagaggcggcgaggtggacc
tgatcatcggatcgggtctgaacgtgctgaacgacctcccgacgacgtcactcgtctcgc
tcgcgcctaacgccagcgcgctccgcgagacgctgcgtatcgaggacctcgcagcgtcgc
tcctcacgcggtttgacgtgctctttgccgagttcgtcgccacccgggggagctttgagc
cattcatggagcgctacatgcgttactggttgcattcggaccaggaggtgatgctcacga
caacggaccctcccacgcgcgtgcgcattgttgggctgtcgcctgagtatggactcctgc
gtaccgtccccgtcgacagagtcgttggccccgaatcgagcaatccatttgctagggatg
cgggctacatcgacttgcagccggacgggaacagcttcgacatgttcgcggggctcatcc
gggtcaaggggtag

DBGET integrated database retrieval system