KEGG   Auricularia subglabra: AURDEDRAFT_111827Help
Entry
AURDEDRAFT_111827 CDS       T03129                                 

Definition
(GenBank) coatomer subunit alpha-2
  KO
K05236  coatomer subunit alpha
Organism
adl  Auricularia subglabra
Brite
KEGG Orthology (KO) [BR:adl00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:adl04131]
    AURDEDRAFT_111827
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:adl04147]
    AURDEDRAFT_111827
Membrane trafficking [BR:adl04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Retrieval pathways
   Coat protein complex I (COP-I)
    AURDEDRAFT_111827
Exosome [BR:adl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AURDEDRAFT_111827
  Exosomal proteins of bladder cancer cells
   AURDEDRAFT_111827
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Coatomer_WDAD COPI_C WD40 ANAPC4_WD40 Nup160 YfdX Ribosomal_60s Clathrin
Motif
Other DBs
NCBI-ProteinID: EJD51205
JGI: 111827
AA seq 1206 aa AA seqDB search
MQMLTKFESKSNRVKGLAFHPTRPLLASSLHNGSVQLWNYQMGTLVDRFDEHDGPVRGVA
FHPSRPLLVTGGDDYKVKVWDIRPQQRRCLFTLHGHLDYVRTVHFHHEMPWIVSASDDQT
IRIWNSTSRTCIAILTGHSHYVMSAQFHPKENLIVSASMDQTVRVWDISSLRKSTPNTAP
GTFDTFDTFSTVKWVLEGHDRGVNWASFHPTLPLIVSAGDDRQIKLWRMSETKAWEVDSC
RGHFNNPYSVLFHPKQELILSAGEDKTIRVWDMSKRTAVQTFRREHDRFWALTGHPELNL
FAAGHDSGLIVFKLERERPAFAVHQDTLYYIRDKYVRQCDLATAADVGVLSVRKLGSQWV
QPRALSFNPAERAVVVTTTSDNGVYELVTLPKNATGAEVGDSAADGKRGPGTTAIFVARN
RLAVLNKTAQTIEIKDLTNTIVKSIKPPAPVTEIFYGGAGNLLLATATAVQLYDIQQSKV
TAEISTPGVKYAVWSADASMVALLSKHTITLANKTLSQNSVIHETIRIKSGAWDDTGVFV
YSTLNHIKYALPNGDNGIVRTLDQPVYLTRVKGKTIHCLDRSARPRTITIDSTEYRFKLA
LVRNNFDEVLQIVKTSNLVGQSIIAYLQKKGFPEIALHFVQEKNTRFDLALECGNLDVAL
EMARAIARPETWSRLAQQALKQGDHKIVEKALQQTKNFDKLSFLYLTTGQADKLAKMQKI
ADTRGDPMSKFHNALYAGDVYSRIAVLRETGLHPLAYLTAMTNGLPDVAQEILDAAGLTQ
EDIQEVPSFPASTLGPPPAITPAGQLVWPAVPAAENFFEQALVNGGLEEPAGAATYANGD
AAGAALDDWANEEAAEEEEEIDVDAGWDLDVEGPEATFDEAAELEVDAGDAGPSASHGIN
ETDLWVRNSPFAADHVAAGDFKSAMQLLNSQCGIVNFEPLKPYFVEIYRSAHVYFSPNAS
MPSLQLHVRRNPDRDAPGQVLPISVKTLAGARTEIKEATRAIQLNQLADAESGLRAALRT
LLFVTVSSDEEAKEWRDVITMAREYLLGVILEQARRKLVEEDPDNVQRSLELAAYFTRCQ
MQPAHLQLALRNAIQVFQKANNHAHAAKFASRLIELNPDPKVVAKARQVVAAGQRNPRNA
VEIAYDETADFEICAATYSPIYKGQPVVHCPYTGAAYVPECKGQLDPLSQLAEIGAPCAG
LPAPRS
NT seq 3621 nt NT seq  +upstreamnt  +downstreamnt
atgcagatgctaacaaaattcgagtcaaaaagcaaccgcgtcaaagggctggcattccac
cccacgcggccgctgctggcgtcgtcgctgcataatggcagcgtccagctctggaactac
cagatgggcaccctcgtcgaccgctttgacgagcacgacggccccgtccgcggcgttgca
ttccacccctcgagaccgcttcttgtgaccggcggcgacgactacaaggtcaaagtctgg
gacatacggccacagcaacggcgctgtctctttacgctccacggtcatctggactatgtc
cgcaccgtacatttccatcatgaaatgccctggatcgtctccgcgtccgacgaccagacg
attcgtatctggaacagcacctcccgcacctgcattgccattctcaccggccactcccac
tatgtcatgtccgcccagttccaccccaaggagaacctcattgtctccgcctccatggac
cagacagtgcgcgtctgggacatctcttcgctacgcaaaagcacccccaacacggccccc
ggtaccttcgacactttcgacacgttctccaccgtcaagtgggtcctcgagggccacgac
cgcggcgtgaactgggcgtccttccaccccacgctcccgctcatcgtctccgctggcgac
gaccgccagatcaagctctggcgcatgagcgagacgaaggcgtgggaggtcgactcgtgc
cgcggccacttcaacaacccgtacagcgttttgttccacccgaagcaggagctcatcttg
tccgccggcgaggataagacgatccgcgtgtgggacatgtcgaagcgcacggccgtgcag
accttccggcgggagcacgaccgcttctgggcgctgaccggccacccggagctcaacctc
ttcgcggcggggcacgacagcgggctgatcgtgttcaagctcgagcgcgagcggcccgcg
tttgccgtgcaccaggacacgctgtactacatccgcgacaagtacgtgcgccagtgcgac
ctcgccacggccgcggacgtcggcgtgctgtccgtgcgcaagctcggcagccagtgggtg
cagccccgcgcgctgagctttaaccccgccgagcgcgcggtggtcgtgacgacgacgtcg
gacaacggcgtgtacgagctcgtcacgctcccaaagaacgcgaccggcgccgaggtcggt
gactccgcggcggacggcaagcgcggccccggcacgaccgccatcttcgttgcgcgcaac
cgcctcgccgtgctcaacaagaccgcgcagacaatcgagatcaaggacttgacgaacacg
attgtcaagtcgatcaagccgcccgcgcctgtgacggagatcttctacggcggcgcgggc
aacctgctgctcgcgacagcgacggcggtgcagctgtacgacatccagcagtccaaggtc
accgcggagatcagcacaccaggcgtcaagtacgccgtgtggagcgcggacgcgtccatg
gtcgcgctgctcagcaagcacaccatcacgctcgccaacaagacactgtcgcagaacagc
gtcatccacgagaccatccgcatcaagtctggcgcgtgggacgacacgggcgtgttcgtg
tactcgacgctgaaccacatcaagtacgcgttgccgaacggcgacaacggcatcgtccgc
acgctggaccagcccgtgtacctgacgcgcgtgaagggcaagacgatccactgcctggac
cgctccgcgcgcccacgcacgatcaccatcgactcgacggagtaccggttcaagctcgcg
ctcgtgcgaaacaacttcgacgaggtgctgcagatcgtcaagacgagcaacctcgtcggg
cagagcattattgcgtacttgcagaagaagggcttccccgagatcgcgctgcacttcgtg
caggagaagaacacgcgcttcgacctcgcgctcgagtgcggcaacctggacgtcgcgctc
gagatggcgcgcgcaatcgcgcgtccggagacgtggagccgcctggcgcagcaggcgctc
aagcagggcgaccacaagatcgttgagaaggcgctgcagcagaccaagaacttcgacaag
ctctcgttcctctacctcaccaccggccaggcggacaagctcgccaagatgcagaagatc
gcggacacgcgcggcgaccccatgtccaagttccacaatgcgctctatgcgggcgacgtg
tattcgaggattgcggtgctcagggaaaccgggcttcacccgctggcgtacttgacggcg
atgacgaacggtctgcctgacgtcgcgcaggagattctggacgcggccggcctgacgcag
gaggacatacaggaggtaccgtccttcccggcgtcgacgctcggcccgccgcccgccatc
acgcccgcggggcagcttgtctggcccgcggtgccagccgcagagaacttcttcgagcag
gcacttgtcaacggcgggctcgaggaacccgctggcgccgcaacgtatgccaacggcgac
gcggccggcgctgcgctggacgactgggcgaacgaggaggcggccgaggaggaggaggag
atcgacgtcgatgctggatgggaccttgacgtcgagggccccgaggcgacatttgacgag
gcggccgagcttgaggtcgacgcgggcgacgcggggccgagcgcaagtcacggcatcaac
gagacggacctctgggtccgcaactcgccattcgctgccgaccatgttgctgcgggcgac
ttcaagtccgctatgcagttactcaacagccagtgcggcatcgtcaacttcgagccgctc
aagccgtacttcgtcgaaatctaccgctccgcgcacgtctacttctcgccgaacgcgtcg
atgccgagcttgcagctgcatgtgcgccgcaatccggaccgcgatgcacccgggcaggtc
ctcccgatttcggtcaagactttggccggcgctcgcacggaaatcaaggaggctacacgc
gcgattcagctcaaccagctggctgacgccgagtctggtctgcgtgcggccctccgcaca
ttgctgtttgttacggtgtcgtcagacgaggaggccaaggagtggcgagacgtcatcacg
atggcacgcgaatacctccttggtgtcatcctggagcaggcgcgccgcaaattggtcgag
gaggatccggacaacgtgcagcgcagcctcgagctcgccgcgtacttcacccgctgccag
atgcagcccgcacacctgcaactcgcgctgcgcaacgccatccaggtgttccagaaggcg
aacaaccatgcgcacgccgccaagttcgcgtcgcggctcatcgagctcaaccccgaccca
aaggtcgtcgcgaaggcacgtcaggtagttgctgctggccaacgaaacccgcgcaacgcg
gtcgagatcgcgtacgacgagacggcggactttgagatctgcgccgcgacgtactcgccg
atatacaagggccagcccgtcgtgcactgtccgtacacaggcgcggcgtacgtgccggag
tgcaagggccagctcgatccgctgtcgcagctcgcggagatcggcgcgccatgcgcgggc
ctgcccgcgccgcgctcgtga

DBGET integrated database retrieval system