KEGG   Auricularia subglabra: AURDEDRAFT_140808Help
Entry
AURDEDRAFT_140808 CDS       T03129                                 

Definition
(GenBank) hypothetical protein
  KO
K05349  beta-glucosidase [EC:3.2.1.21]
Organism
adl  Auricularia subglabra
Pathway
adl00460  Cyanoamino acid metabolism
adl00500  Starch and sucrose metabolism
adl01100  Metabolic pathways
adl01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:adl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AURDEDRAFT_140808
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    AURDEDRAFT_140808
Enzymes [BR:adl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     AURDEDRAFT_140808
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_3_C Glyco_hydro_3 Fn3-like CBM_1
Motif
Other DBs
NCBI-ProteinID: EJD55142
JGI: 140808
AA seq 807 aa AA seqDB search
MAFAIGALKALAVLATLAASTHAQQPVWAQCGGIGWTGGTTCVAGATCVKQNDYYSQCIP
GAQAPTTSSSATQTTVGPTTTTSATSTPTAVPTGDWAAAISKAKAAVAKMSTQDKVNLAT
GIGWMVGACVGNIAPISSINFPGLCLEDGPLGVRYADLVSAFPAGINAAATFNRDLIKQR
GVALGAEFRGKGAHVILGPDMNIMRVPAAGRNWEGFGADPYLSGEAAFETIQGIQSQGVQ
ANAKHYINNEQEHFRSSGSSNVDDRTEHEIYLPPFLQSIRAGVASFMCSYNRINGTFSCS
NSRTLNDILKGEMGFQGYVMSDWDAQHAVTDANAGLDMTMPGDGLGGGSFFGAQLTQAVG
NGTVPTARLNDMSTRTLAAFYLLGQDSGFPATNFHAWQASRGQHINVQGNHGQLIRQIGA
ASAVLLKNVNSALPLNKPKTIGIIGSHAGPNSRGPNGYSDRAGNDGVLAMGWGSGTADFP
YLIDPLAAIKNRSSTDGTTVTSSLNDNDTTAAHNAAANKDAAIVFITADSGEGYLTVEGN
AGDRNNLDPWHNGNNLVAAVAGANKNTIVVVNSVGPIIVDSWINHVNGTGVIWAGLPGQE
AGNALVDVLYGAVNPSGRLPYTIAKTPADYPAQLITAGSGNVAITYSEGLNVDYRHFDAK
NIAPRFEFGFGLSYTTFAYSNLKVTSGSFSKLGPTGPGSSIADSLHAPAVTVSFTLTNNG
TLTGTEIPQLYLNLPASANSPPNSLKGFDAVSLAAGASQTVSFTLSQYDLSIWDVAQQRW
VVPTGTFGVTVGASSRDKRLSGSLVVA
NT seq 2424 nt NT seq  +upstreamnt  +downstreamnt
atggcctttgcgatcggtgcgctcaaggccctcgctgtgctcgcgacgctcgcggcgtct
acgcacgcacagcagcccgtctgggcccaatgtggcggcattggatggacgggcgggact
acttgtgtggccggcgctacttgtgtcaagcagaatgactactactcgcaatgcatccct
ggcgctcaagcaccaactacgagtagctctgcgacgcagaccacggttggaccgacgaca
actaccagcgcgacgtcgacgcccaccgctgtgccaaccggggattgggccgcagccatt
tcgaaggcgaaggctgctgtggcaaagatgagcactcaggacaaggtcaacctcgctaca
ggtatcggctggatggtcggcgcatgtgtaggcaacattgctccgatttccagtatcaac
ttccctggcttgtgtcttgaggatggccccctcggtgtacgctatgcagacctcgtctct
gccttccccgcaggaattaacgcagctgcgaccttcaaccgcgacttgatcaagcagcgt
ggggtcgcgctcggtgctgagttccgtggcaaaggcgcacacgtcattctcggccccgac
atgaatataatgcgcgtgccggctgcgggacgtaactgggagggctttggcgcggaccca
tacctttcgggagaggcggcgttcgagacgatccagggcatccagagccagggcgtgcag
gccaacgcaaagcactatatcaacaacgagcaagaacacttccgctcgtctggctcgtcg
aatgtggatgaccgcacggagcatgaaatctacctccctcccttcttgcaatccattcgc
gccggagtcgcttcctttatgtgctcgtacaacagaatcaacggcacattctcttgcagc
aactcgaggaccttgaacgacatcctcaagggggagatgggattccaaggatacgtcatg
tcggattgggacgctcagcatgctgtcacggatgccaatgctggactcgacatgaccatg
cctggcgacggactcggcggcgggagcttcttcggtgcgcagttgacgcaggccgtgggc
aatggcacggtgccgacggcgcgcctcaatgatatgtctacgcgcacgctggctgctttc
tacctgctcgggcaggactccggtttccctgcaaccaattttcacgcgtggcaagcgtcg
cgtggccagcacatcaacgttcaaggcaaccacggacagctcatccgtcagatcggcgca
gcctctgccgtcctcctaaagaacgtcaacagcgcgctccctctgaacaagcccaagacc
attggcatcatcggaagccacgctggacccaactcgcgcgggcccaatgggtacagtgac
cgtgccgggaacgacggcgtacttgccatgggctggggatcgggcaccgcggacttcccg
tacctcatcgacccgctcgcggctatcaagaaccgctcgtcgactgacggcacgacggtc
acgtccagcttgaacgacaacgatacgactgccgctcacaacgctgctgccaataaggat
gctgccatcgtattcataaccgccgactctggagagggctacttgactgtggaaggcaac
gcaggcgaccggaacaacttggacccttggcacaatggcaacaacctcgtcgctgccgtc
gcgggcgcgaacaagaacacaattgtcgtcgtcaacagcgtcggccccattatcgtggac
tcttggatcaaccacgtcaatggtaccggtgtgatatgggccggtcttcctggtcaagaa
gctggcaatgctctcgtcgatgttctctacggtgctgtcaacccgtcgggccggctgccg
tacaccatcgcaaagactcctgcagactatccggctcagctgatcacggcaggatctggc
aacgtagccatcacatacagcgaaggattgaacgtcgactaccgtcatttcgacgcgaaa
aacattgctcctcgcttcgagtttggcttcgggctctcgtacacgacatttgcctactcg
aacctgaaggtcaccagcgggtcgttctccaagctcggccccaccggcccaggctccagc
attgctgactctcttcacgcccccgcggtcaccgtgtccttcacgttgacgaacaacggc
acgctgaccggcactgagatcccacagctctacctgaacctgccggcgtcggccaactcg
ccgcccaactcactcaagggtttcgatgccgtctccctcgcggctggcgcatcgcagacg
gtctcgtttacgctgtcgcaatacgacctctccatttgggatgtcgcgcagcagcgctgg
gtcgtgccgacgggcacgttcggcgtcacggtgggcgcgagcagccgcgacaagcggctc
tcgggctcgctcgtcgtcgcgtga

DBGET integrated database retrieval system