KEGG   Auricularia subglabra: AURDEDRAFT_155970Help
Entry
AURDEDRAFT_155970 CDS       T03129                                 

Definition
(GenBank) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
adl  Auricularia subglabra
Pathway
adl00430  Taurine and hypotaurine metabolism
adl00620  Pyruvate metabolism
adl00640  Propanoate metabolism
adl00680  Methane metabolism
adl01100  Metabolic pathways
adl01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:adl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AURDEDRAFT_155970
   00640 Propanoate metabolism
    AURDEDRAFT_155970
  09102 Energy metabolism
   00680 Methane metabolism
    AURDEDRAFT_155970
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    AURDEDRAFT_155970
Enzymes [BR:adl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     AURDEDRAFT_155970
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acetate_kinase F-box_5
Motif
Other DBs
NCBI-ProteinID: EJD54191
JGI: 155970
AA seq 433 aa AA seqDB search
MTGDGSDLLLAVNCGSSSIKFKLYELPNLHVLISGSASNVAVQGARALIKYTVHAEQIEE
EREEEEEGMAYDEVFERIIRHLEDSSPEHQGRHAISIVAHRVVHGGTQTDPMIIYKGHEE
GLELLDKLSEFAPLHNHRSVTTVRSCLQHLPNSTQVLCFDTLFHASLPPHIYTYPLAPPE
HAPPIPLRKYGAHGLSYASILRDVAAFLDKPQKECTLVVAHLGSGASVCMIRDGKSADTS
MGVSPLEGLPGGTRSGSVDPVLVFHHTPGCADMVEQGGGLVSKAELVLNKQGGLQAICGT
SDFGRILSRMGDARDTTARLAYDVFLDRVLNFVGAYMLKLAGAGARVDGVVFSGGIGERA
ARLRADVARYLGAFGGELDKARNEEGEKDSEGNVKRISSDASKLGIFVCKTDEETQCARM
ARDWVKEHPREDA
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgaccggcgacggttccgacctcctgctcgccgtcaactgcggctcgtcgtcgatcaag
ttcaagctctatgagctgcccaacctccatgtcctcatctccggctccgcgagcaacgtc
gccgtccagggcgcacgcgcgctcatcaagtacaccgtgcacgccgagcagatcgaggag
gagcgcgaagaggaggaggagggcatggcctacgacgaggtcttcgagcgcatcatccgc
catctcgaggactcgagccccgagcaccagggccgccacgccatatcaatcgtcgcccat
cgcgtcgtccacggcggcacacaaaccgatcccatgattatatacaagggccacgaggag
ggcctcgagctgctcgacaagctcagcgagttcgcgccgttgcacaatcatcgctcagtt
accacggtccgctcatgtctgcaacacctgccaaactcaacccaggtcctctgcttcgac
acgctcttccacgcctcgctcccgccgcacatctacacctacccgctcgcgccgccggag
cacgcgccgccgatcccgctgcgcaagtacggcgcgcacgggctctcgtacgcgagcatc
ctgcgcgacgtcgcagccttcctggacaaaccgcaaaaggagtgcacgctcgtcgtcgcg
cacctcgggagcggcgcgagcgtctgcatgatccgcgacggcaagagcgcggataccagc
atgggcgtgagcccgctggagggcctgccgggcggcacaaggtcggggagcgtggacccc
gtgctggtgttccaccatacgcccgggtgcgcggacatggtcgagcagggcggcgggctc
gtgtcgaaggcggagctggtgctcaacaagcagggcggcctccaggccatctgcgggacg
tccgacttcggcaggattctctcgcggatgggcgacgcgcgcgacacgacggcgcggctc
gcgtacgacgtcttcctcgaccgcgtgctcaacttcgtcggcgcgtacatgctcaagctc
gccggcgccggcgcgcgcgtcgacggcgtcgtgttcagcggcggcatcggcgagcgtgcc
gcgcggctgcgcgcggacgtcgcgcgctaccttggcgcgttcggcggcgagctggataag
gcgaggaacgaggagggcgagaaggacagcgaggggaacgtcaagcgcatctcgagcgac
gcctcgaagctgggcatctttgtgtgtaagacggacgaggagacgcagtgcgcgcgcatg
gcgcgagattgggtcaaggagcatccgagggaggatgcgtaa

DBGET integrated database retrieval system