KEGG   Auricularia subglabra: AURDEDRAFT_162130Help
Entry
AURDEDRAFT_162130 CDS       T03129                                 

Definition
(GenBank) hypothetical protein
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
adl  Auricularia subglabra
Pathway
adl00350  Tyrosine metabolism
adl00360  Phenylalanine metabolism
adl00380  Tryptophan metabolism
adl01100  Metabolic pathways
adl01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:adl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    AURDEDRAFT_162130
   00360 Phenylalanine metabolism
    AURDEDRAFT_162130
   00380 Tryptophan metabolism
    AURDEDRAFT_162130
  09110 Biosynthesis of other secondary metabolites
   00901 Indole alkaloid biosynthesis
    AURDEDRAFT_162130
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:adl04147]
    AURDEDRAFT_162130
Enzymes [BR:adl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     AURDEDRAFT_162130
    4.1.1.105  L-tryptophan decarboxylase
     AURDEDRAFT_162130
Exosome [BR:adl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AURDEDRAFT_162130
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: EJD48673
JGI: 162130
AA seq 483 aa AA seqDB search
MDIEQFRKAGYAAIDQICENYKQLEQHPVVSQVEPGYLRKLLPEQVPEDGERIEAITNDF
QEVILPGITHWQHPSFFAYFPSNATFESMLGELYATSVNNPGFNWTCSPAATELEAVVMD
WAAKLFGLSSEFQHTSGRGGGVMMTTASDSALTAVVAARSRYLAKHKGVPQEKLVIYTST
QTHSLGAKAALILGLGIRALPVTAEDEYALRGHVLKSAMEEDFKAGRRPFILIATVGTTS
SGAVDRLDEVATIAEEYPDIWIHVDAAWAGVALSCPEYREKAFLNYINLNAHSFCTNFHK
WGLTHFDASTLWVRDRALLTTALDITPEFLRTKAADTGLVIDYRNWHLALGRRFRSLKLW
FVLRSYGVKGFQAHIRKGIAHAKLFASLVEASPHLEIFVPPSFALVVFRIRGVDEAVNRA
FFGHLADRPDVYLTHTEMNGTFCVRFAVGGVLTEERHVRHAYDVVAEVARQTLKEKGLLA
AEG
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atggatatcgaacagttcaggaaagccggatacgctgcaatcgaccagatatgcgagaac
tacaagcagctcgagcaacaccccgttgtctcccaggtagagcccggataccttcgcaag
cttctccctgagcaggtgcccgaggatggagaacggatcgaagcaatcacaaatgacttt
caggaggtcattttgcctggcatcacgcactggcaacatcccagcttctttgcttacttc
ccttcgaatgcgacattcgaaagcatgctcggcgagctgtatgcgacgagcgtcaacaac
cctggattcaattggacatgcagccctgcggcgactgagctcgaagcggtcgtgatggac
tgggccgcgaagctgttcggtctctcctccgagtttcagcatacctctgggcgtggaggc
ggggttatgatgacgacagcctcggattccgccttgaccgctgttgtagctgcgcggtca
cgctatctggccaagcacaagggcgtcccgcaagagaagctcgtcatatacacgagcacg
cagacgcacagcttgggcgcgaaggccgcgttgattctcgggcttgggatacgcgccttg
cccgtcactgccgaggacgaatacgccctgcggggccatgtactcaagtccgcaatggaa
gaagacttcaaagccgggcggcgaccgttcatcctcattgccacagtgggaactacgagt
tctggtgcagtcgatcggctcgacgaagtcgcaacgattgccgaagagtatcctgacatc
tggatccacgtcgacgccgcgtgggcaggtgtcgcgctctcctgccccgagtaccgtgag
aaggcgttcctcaattatatcaatttgaatgcgcattcattctgtaccaacttccataag
tggggcttgacccactttgacgcatcgacgctctgggtacgggatcgcgccctgctcacg
actgccctggacatcacgcccgagttcctgcgtacgaaggccgcagacaccggcctcgtc
attgattatcgcaactggcacctcgccctcgggcggcgctttcggtcgctgaagctttgg
ttcgtcctgcgcagctacggcgtcaagggcttccaggcgcacatccgcaagggaatcgca
catgccaaactcttcgcgtctctcgtcgaggccagcccgcatctcgagatcttcgtccct
ccatcattcgcgctcgtcgtcttccgcattcgcggcgtcgacgaggccgtgaaccgcgcg
ttcttcggacatcttgccgaccggccagacgtctaccttacgcatacggagatgaacgga
acgttctgcgtacgcttcgctgtgggcggcgtcttgaccgaggagcggcacgtccgccat
gcgtacgatgtcgtcgccgaggttgcgcgccagacgcttaaagagaaaggccttttggca
gcggagggctga

DBGET integrated database retrieval system