KEGG   Auricularia subglabra: AURDEDRAFT_164075Help
Entry
AURDEDRAFT_164075 CDS       T03129                                 

Definition
(GenBank) PLP-dependent transferase
  KO
K01739  cystathionine gamma-synthase [EC:2.5.1.48]
Organism
adl  Auricularia subglabra
Pathway
adl00270  Cysteine and methionine metabolism
adl00450  Selenocompound metabolism
adl00920  Sulfur metabolism
adl01100  Metabolic pathways
adl01110  Biosynthesis of secondary metabolites
adl01130  Biosynthesis of antibiotics
adl01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:adl00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    AURDEDRAFT_164075
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    AURDEDRAFT_164075
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    AURDEDRAFT_164075
Enzymes [BR:adl01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.48  cystathionine gamma-synthase
     AURDEDRAFT_164075
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cys_Met_Meta_PP Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: EJD47016
JGI: 164075
AA seq 535 aa AA seqDB search
MSLGEPIPAGSHHSLSVSLPEWRDNVGYQEAEPRVMNLLRTGYPRFVIHESVKELSEIIL
QRAGRPGERALPFPSRKVASAFKAFCGDATRILALDIGDAPSGTDINLHVVLFPEDVLPR
AKAFWQHTGWGISSRLADFCRARLRSPNAQAVDASTLAVCPNAQGAKRVLRERIAGAVKR
EHPGSALRGHVDVSSDDVFLYPSGMSAIWAAHQLVLAVRPAAKSVCFGHVSFHRSPPAHV
LTKWGPGCQFFGEGDSADMKALEMLLAATRSANPSEPPVLAIFCETPSNPLLRSVDVERF
RMLADQYDALLVIDETIGNFVNVDVLPVADILVTSLTKVFSGAQNVMGGSLVLNPNGRHY
TALLSSLEGSFEDLYWPEDALEMERNSRDFATRVYKINANAEALADFLLSSDSAALKHVF
YPKWETRQLFDALRRPGGGFGGLLSITFAADAAAHAFYDALRCHKGPSLGTNFTLACPYT
ILAHYAEREWAARYGVEEGLVRISVGLEPVEELLDICRVAVDAAEAALCRPRLLT
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctaggggagcccatccctgccggctcgcatcacagtctctccgtctccctaccc
gagtggagagataatgtcgggtatcaggaggctgagccgcgggtcatgaacctcctgcga
acgggttaccctcgttttgtgatccacgagtctgtaaaagagctctcagaaatcatactc
caacgcgctggacggccaggcgagcgagctctgcccttcccaagcagaaaagtcgcatcg
gccttcaaagctttctgtggcgacgccacgcggatcctcgcactcgacatcggcgacgct
ccctccggaacagacatcaacttgcacgtcgtcttgttccccgaggacgtgctcccacgc
gccaaggcattctggcagcacacgggctggggcatctcgagccgcctcgcggacttttgc
cgcgcgcgtctgcggtcccccaatgctcaggcagtagatgccagtaccctagcggtctgc
cccaacgcacagggtgcaaagcgcgtgttgcgagagaggatcgcgggtgctgtgaagcgc
gagcatcctggctctgctcttcgcggacacgtcgacgtctcctcagacgatgtgttcctc
tacccctcaggcatgtcggcgatctgggccgcgcatcagctcgtgctcgccgtgcgcccc
gcggcgaagagcgtctgcttcgggcacgtctccttccaccgttccccgcctgcgcatgtg
ctcaccaaatggggccccggatgccagttcttcggtgagggagacagcgccgacatgaag
gcattggagatgctccttgccgccacccgcagcgcgaatccgtcggagcctccggtactg
gcaatattctgcgaaacaccgtccaacccgctcctgcgctccgtggacgtcgaaaggttt
cgcatgctggccgatcagtacgacgcgctgctcgtgatcgacgagacgattgggaatttc
gtcaacgtcgacgtcctgcccgtcgccgacatcctggtgaccagtctcaccaaggttttt
agcggcgcgcagaacgtgatgggcgggagtcttgtgctcaacccaaacgggcgccactat
accgccctgttgtcctcattggagggatcgttcgaggatctctactggccggaagacgcg
ctcgagatggagcgcaactcgcgcgacttcgccacccgcgtgtacaaaatcaacgcgaat
gcggaggccctcgcggatttcctgctctcgtccgattctgcggcgctcaaacacgtcttc
tacccaaaatgggagacacgacagctgttcgacgcgctccgtcgccccggaggtggattc
ggcgggctgctgagcatcacgttcgccgcggacgccgcggcgcacgcgttctacgacgcg
ctgcgctgccacaagggcccgagcctcgggacaaacttcacgctcgcgtgcccgtacacc
atcttggcgcactatgccgagcgcgagtgggcagcgcggtacggtgtcgaggaggggttg
gtcaggatcagtgtcgggctcgagccggtggaggagcttttagatatttgtcgtgtcgcg
gtggacgccgctgaggctgctctctgtaggccaagactattgacttga

DBGET integrated database retrieval system