KEGG   Auricularia subglabra: AURDEDRAFT_167052Help
Entry
AURDEDRAFT_167052 CDS       T03129                                 

Definition
(GenBank) hypothetical protein
  KO
K04097  prostaglandin-H2 D-isomerase / glutathione transferase [EC:5.3.99.2 2.5.1.18]
Organism
adl  Auricularia subglabra
Pathway
adl00480  Glutathione metabolism
adl00590  Arachidonic acid metabolism
adl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:adl00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    AURDEDRAFT_167052
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AURDEDRAFT_167052
Enzymes [BR:adl01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     AURDEDRAFT_167052
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.99  Other intramolecular oxidoreductases
    5.3.99.2  prostaglandin-D synthase
     AURDEDRAFT_167052
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_C_3 GST_C_2 GST_N GST_N_3 GST_C FAM150
Motif
Other DBs
NCBI-ProteinID: EJD44001
JGI: 167052
AA seq 235 aa AA seqDB search
MAHSARYEFTYFRLHGLGDLSRLLMDVAEVPYKNKFVDFDDSWTAVKESMTFGKVPRLTV
LGSDGTKQELFESSAIEAYLAEALSFVPASDLFSRAECFSVAASIKDLDDKVHATSFLST
VEERRAAHEKNVAELIPSFLRYHERFLAARGGPYFFGSKVTIADLRLYVVYLKFDEIYGA
TNPFTAQKAQFPRLARLIETLDSGRAGDYARKRRSVGGSFRWLEDELKWATPKKA
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atggcacattcggctcgctatgaattcacctacttccgtcttcacggactcggagaccta
tctcgactcctgatggacgtcgccgaggtcccttacaagaacaagttcgtcgacttcgat
gacagctggactgctgtcaaggagtcgatgacattcgggaaagttcctcggttgaccgtt
ctgggttcggatgggacgaagcaggagctgttcgagtccagcgcgattgaggcttacctc
gccgaggccctctccttcgtgcccgcgtccgatctcttctcccgcgcagagtgcttcagt
gtcgcggcatccatcaaggacctcgacgacaaggtgcatgcgacgtccttcctgtccaca
gtcgaagagcgccgcgccgcacacgagaaaaacgtcgcagaactaatcccgtcgtttctg
cgctaccatgagcgcttcctcgccgcccgcggagggccatacttcttcgggagcaaggtc
acgattgccgacctgaggctctacgtcgtgtatctcaagttcgacgagatatacggcgcg
accaaccctttcacggcgcagaaagcgcagttccccaggctcgccaggttgatcgagacc
ctggattctggtcgcgccggcgactacgcgcgcaaacgtcgctctgttgggggaagcttc
cgatggcttgaagacgagttgaagtgggcaacaccaaagaaggcatga

DBGET integrated database retrieval system