KEGG   Auricularia subglabra: AURDEDRAFT_180592Help
Entry
AURDEDRAFT_180592 CDS       T03129                                 

Definition
(GenBank) RNA-binding domain-containing protein
  KO
K09564  peptidyl-prolyl isomerase E (cyclophilin E) [EC:5.2.1.8]
Organism
adl  Auricularia subglabra
Pathway
adl03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:adl00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    AURDEDRAFT_180592
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:adl03041]
    AURDEDRAFT_180592
   03110 Chaperones and folding catalysts [BR:adl03110]
    AURDEDRAFT_180592
Enzymes [BR:adl01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     AURDEDRAFT_180592
Spliceosome [BR:adl03041]
 Complex B
  Other components
   Prp19-related factors
    AURDEDRAFT_180592
 Complex C
    AURDEDRAFT_180592
Chaperones and folding catalysts [BR:adl03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    AURDEDRAFT_180592
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RRM_1 RRM_7 Nup35_RRM
Motif
Other DBs
NCBI-ProteinID: EJD52999
JGI: 180592
AA seq 147 aa AA seqDB search
MPEDGPASKKTVFIANVAEGVDESALLEGFSTFGDVVDVQLPLAATNPAHTEDKRHRGFA
FVTYAAAADAQDAIDNMDLNVFHGKVIKVNIATSTKMAAQPAGNRPVWETEEWLKTYGNT
QGKGGKAVTNAPAAEPAKEADEDAMEE
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atgccggaggacggtccggcgtcgaaaaagacggtgttcatcgcgaacgtcgcggagggc
gtggacgagagcgcgttgctcgaaggcttctcgacgttcggtgatgtcgtcgacgtgcag
ttgccgttagcagcgacgaaccctgcgcacacagaagacaagcggcatcgcgggttcgcg
ttcgtcacgtacgccgccgcggcggacgcgcaggacgcgatcgacaacatggacctgaac
gtgttccacggcaaggtcatcaaggttaacatcgcgacgtccaccaagatggctgcccag
cctgcgggcaaccggccagtatgggaaaccgaggagtggctcaagacgtacggcaacacg
cagggcaagggtggcaaggccgtcacgaacgcgcctgcggccgagccagcaaaagaggcg
gacgaggacgccatggaagaatga

DBGET integrated database retrieval system