KEGG   Auricularia subglabra: AURDEDRAFT_50894Help
Entry
AURDEDRAFT_50894  CDS       T03129                                 

Definition
(GenBank) hypothetical protein
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
adl  Auricularia subglabra
Pathway
adl00052  Galactose metabolism
adl00500  Starch and sucrose metabolism
adl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:adl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    AURDEDRAFT_50894
   00500 Starch and sucrose metabolism
    AURDEDRAFT_50894
Enzymes [BR:adl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     AURDEDRAFT_50894
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-ProteinID: EJD54989
JGI: 50894
AA seq 494 aa AA seqDB search
MATSVYDGPLRPQAHFSPAKNFMNDPCGCFQDSHGLWHLYYQYNPEGLVVGNQHWGHVTS
RDLYHWREHPIALSPPRADSQAFDGSIVLDVNNTSGLFPSPSPSNIAAVYTLNTPTREVQ
HLAYSLDGGYSFLEYTGNPVIDSESTQFRDPKVSWHGETGKWVMVVAYAQDLTIGFYTST
NLRLWEHASNFSFPSLPGAQWECPNLVQLPVLHSPANEKKWVLKLSVNPGAPLGGSIDVH
FVGAFNGTHFASSSYALADFAKDDYAAQSFYGAEDVSVAWASNWDYAQDMPTDREGWRSA
MTLPRRNYLAQDAQGAWIVFQAPYRIGTVLGKVLAASHDLASHQLAVDFARVVPAAVYFR
ATVSGLADVYLSGDTWLNFTVYSPVSGESLSGSYRLAGGEFALDRGNTRGFSHPNFTPNF
SMVSKADPSGRWKVEGIIDRSIVEVFLDGGKHVATVSYFPLEPLTLFTIDAVALPRDVRV
RVLVWAVNSIWPDY
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccagcgtgtatgacggcccgctgcgtccccaagcgcacttctcgcccgcgaaa
aacttcatgaacgacccgtgcggatgcttccaggactcccatgggctctggcacctctac
taccaatacaaccccgaaggtcttgtcgtgggaaaccaacactgggggcacgttacaagc
cgagatctgtaccactggcgcgaacaccccatcgcactctcgccgccgcgcgcggactcg
caggcgtttgacggttcgatcgtactcgacgtgaacaacacttcgggcctcttcccctcg
ccctccccgtccaacatcgcggcagtatacacactcaacacgcccaccagggaggtgcag
cacctggcctactcgcttgatgggggatactcctttcttgagtacacaggcaaccccgtg
atcgacagcgagtcgacgcagttccgcgacccgaaggtctcctggcacggcgagacgggg
aagtgggtgatggtcgttgcgtacgcgcaggacctcacgatcgggttctacacctcgaca
aacttacgactgtgggagcacgcgtcgaacttctccttcccgtctctccccggtgcgcag
tgggagtgcccgaacctcgtacagctgcctgtgctgcactcgcccgcgaacgagaagaag
tgggtcctcaagctcagcgtcaaccctggcgcgccgctcgggggcagcatcgacgtgcac
tttgtcggggcgttcaacggcacgcatttcgcaagtagctcatacgccctcgcggacttt
gcgaaggacgattacgccgcacagtctttctacggcgctgaggatgtgtcggttgcgtgg
gcgtcgaattgggactacgcgcaggatatgccgacggaccgcgagggctggcgcagcgcg
atgaccttgccgcggcgcaattacctggcacaagacgcccagggcgcatggatcgttttc
caggcaccgtatcgtattgggactgtgctaggcaaagtgctcgctgcctcgcatgatctg
gccagtcatcagctggccgtcgactttgcacgcgtcgtgcctgctgcggtatacttcagg
gcgacagtctcggggctcgcagacgtctatctgtcgggcgatacgtggctaaacttcact
gtctattcgcccgtctccggggagagtctgtctgggagctatcgtttggcaggaggcgag
tttgctctggatcgcgggaacacgcgtgggttctcgcatccgaatttcactcccaacttc
tctatggtctccaaggcagacccatccgggagatggaaggtcgagggtatcatcgatagg
agcatcgtggaggtcttcctcgatggcggaaaacatgttgctactgtctcctatttccct
ctcgaaccgttgacgctgtttactatcgacgctgtcgcgctcccgagggatgtacgggta
agagtactagtgtgggctgtcaatagtatttggccggattactag

DBGET integrated database retrieval system