KEGG   Auricularia subglabra: AURDEDRAFT_55566Help
Entry
AURDEDRAFT_55566  CDS       T03129                                 

Definition
(GenBank) hypothetical protein
  KO
K09577  FK506-binding protein 14 [EC:5.2.1.8]
Organism
adl  Auricularia subglabra
Brite
KEGG Orthology (KO) [BR:adl00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:adl03110]
    AURDEDRAFT_55566
Enzymes [BR:adl01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     AURDEDRAFT_55566
Chaperones and folding catalysts [BR:adl03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   FKBP
    AURDEDRAFT_55566
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FKBP_C Porin_3
Motif
Other DBs
NCBI-ProteinID: EJD52465
JGI: 55566
AA seq 147 aa AA seqDB search
MKFLSAVAVLALALGALSKENSEVTELKIETTYKPEGCTQTAAKGDKIKVHYTGTLYTTG
AKFDSSLSGPVVLSARTHPSGLAVGVGQVIKGWDEGLLGMCEGEKRVLTIPADKAYGSRG
FGSVIPANSALVFDVEMVSLPPARQEL
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atgaagttcctgtccgccgtcgccgtcctcgcgctcgccctcggcgcgctctccaaggag
aacagcgaggtcacggagctcaagatcgagacgacgtacaagcccgagggctgcacccag
accgccgcaaagggcgacaaaatcaaggtgcactacaccggcactctctacacgacgggc
gccaagttcgactccagtctatctgggcctgttgtcctgtcagcccgcactcacccgtct
gggcttgcagtgggtgtgggccaggtcatcaagggatgggacgagggtctcctcggaatg
tgcgagggcgagaagcgcgtgctcaccatcccggccgacaaggcatacggctcccgcggc
ttcggcagcgtcatccccgcaaactcggcactcgtcttcgacgtcgagatggtcagcctg
ccgccggcgcgccaggagctgtaa

DBGET integrated database retrieval system