KEGG   Alicycliphilus denitrificans BC: Alide_0872Help
Entry
Alide_0872        CDS       T01397                                 

Definition
(GenBank) UDP-N-acetylglucosamine 1-carboxyvinyltransferase
  KO
K00790  UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
adn  Alicycliphilus denitrificans BC
Pathway
adn00520  Amino sugar and nucleotide sugar metabolism
adn00550  Peptidoglycan biosynthesis
adn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:adn00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Alide_0872
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Alide_0872
Enzymes [BR:adn01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     Alide_0872
Peptidoglycan biosynthesis and degradation proteins [BR:adn01011]
 Precursor biosynthesis
  Transferase/Dehydrogenase
   Alide_0872
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EPSP_synthase
Motif
Other DBs
NCBI-ProteinID: ADU98637
UniProt: E8U089
Position
927747..929021
Genome map
AA seq 424 aa AA seqDB search
MDKLLVRGGRALRGEVVISGAKNAALPEMCAALLTDEPVHLINVPRLHDVRTMRRLLDNM
GVKTETHGERGGMSFVAPDALSPEAPYELVKTMRASVLALGPLLARFGEATISLPGGCAI
GSRPVDQHIKGLQAMGAHIVVEHGYMIAKLPAGQQRLRGARITTDMITVTGTENLLMAAT
LAEGETVLENAAQEPEVTDLAEMLIAMGARIEGHGTSRIRIQGVERLHGCTHQVVADRIE
AGTFLCAVAAAGGEAFLRHARADHLDAVIDKLLEAGARVAAEGDGIRISSPGGAELKAQS
FRTTEYPGFPTDMQAQFMALNVVAQGTAMVAETIFENRFMHVNELARLGAQIAIDGRVAT
VTGGARLSGATVMATDLRASASLVIAGLIASDETLVDRIYHLDRGYDAMEAKLRGLGADI
ERIQ
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atggacaaactactggtacgcggcggccgcgccctgcgcggcgaggtcgtcatctccggc
gccaagaacgcggccctgcccgagatgtgcgccgccctgctcaccgacgagcccgtgcac
ctgatcaacgtgccgcgcctgcacgacgtgcgcaccatgcgccgcctgctcgacaacatg
ggcgtgaagaccgagacccatggcgagcgcggcggcatgagcttcgtcgcgcccgacgca
ctcagccccgaggcgccctacgagctggtcaagaccatgcgcgcctcggtgctggccctg
ggcccgctgctggcgcgcttcggcgaggccacgatctccctgcccggtggctgcgccata
ggctcgcgccccgtggaccagcacatcaagggcctgcaggccatgggcgcccacatcgtg
gtcgagcatggctacatgatcgccaagctgcccgcgggccagcagcgcctgcgcggcgcg
cgcatcaccaccgacatgatcaccgtgaccggcaccgagaacctgctcatggccgccacg
ctggccgagggcgagacggtgctggagaacgccgcgcaggagcccgaggtgaccgacctg
gccgagatgctcatcgccatgggcgcgcgcatcgagggccacggcacgagccgcatccgc
atccagggtgtggagcggctgcacggctgcacgcatcaggtggtggccgaccgcatcgag
gccggcaccttcctgtgcgccgtggcggccgcgggcggcgaggccttcctgcgccacgcg
cgcgcagaccacctggacgcggtcatcgacaagctgctggaggccggcgcgcgcgtggcg
gccgagggcgacggcatacgcatcagcagccccggcggcgccgagctcaaggcgcagagc
ttccgcaccaccgaatacccgggctttcccaccgacatgcaggcgcagttcatggcgctg
aacgtggtggcgcagggaacggccatggtggccgagacgatcttcgagaaccgcttcatg
cacgtcaacgaactggcgcgcctgggcgcgcagatcgccatcgacggccgcgtggccacg
gtgacgggcggcgcgcggctctcgggcgccaccgtcatggccaccgacctgcgcgcctcg
gccagcctggtgatcgccggcctgatcgccagcgacgagaccctggtggaccgcatctac
cacctggaccgcggctacgacgccatggaagccaagctgcgcggcctgggcgcggacatc
gaaagaatccaatga

DBGET integrated database retrieval system