KEGG   Alicycliphilus denitrificans BC: Alide_1036Help
Entry
Alide_1036        CDS       T01397                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
adn  Alicycliphilus denitrificans BC
Pathway
adn00230  Purine metabolism
adn01100  Metabolic pathways
Module
adn_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:adn00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Alide_1036
Enzymes [BR:adn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Alide_1036
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_33 AAA_16 ABC_tran RsgA_GTPase MMR_HSR1 AAA_22 Methyltransf_12 AAA_29
Motif
Other DBs
NCBI-ProteinID: ADU98801
UniProt: E8U1J7
Position
1103463..1104083
Genome map
AA seq 206 aa AA seqDB search
MDYPGNLFVVSAPSGAGKSSLVKALLELDSHVQPSVSHTTRAPRGQEKHGREYFFVSEQE
FDAMVAANGFVEWANVHGRRYGTSRKAIEERVALGADVVLEIDYQGALQIKQAFVNAVLI
FILPPSWEELRSRLERRGEDAADVIDLRLKNAEEEMAQAGKFDFVIINEVFERALFDLKT
IVHAQRLKYAAQRRARADTFESLNIP
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atggattaccccggaaatttgttcgtagtctctgctcccagcggggcgggcaagtcgagc
ctggtgaaggcgcttctggagctggactcgcacgtgcagccctcggtgtcgcacaccacg
cgtgcgccccgtggccaggaaaagcacgggcgcgagtatttcttcgtctccgagcaggag
ttcgacgccatggtggcggccaacggcttcgtggagtgggcgaacgtgcacgggcggcgc
tacggcacctcgcgcaaggccatcgaggagcgcgtggccctgggcgcggacgtggtgctg
gagatcgactaccagggtgcgctgcagatcaagcaggccttcgtcaacgcggtgctgatc
ttcatcctgccgcccagctgggaggagttgcgctcgcgcctggagcggcgcggcgaggat
gccgccgacgtgatcgatctgcggctgaagaacgctgaggaggagatggcgcaggccggc
aaattcgacttcgttataatcaacgaggtgtttgaacgagcgcttttcgatctgaaaacc
attgttcacgcccagcgtctcaagtacgccgcccagcgccgcgcccgggccgacaccttt
gaatcgctcaacatcccctga

DBGET integrated database retrieval system