KEGG   Alicycliphilus denitrificans BC: Alide_1044Help
Entry
Alide_1044        CDS       T01397                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
adn  Alicycliphilus denitrificans BC
Pathway
adn00010  Glycolysis / Gluconeogenesis
adn00051  Fructose and mannose metabolism
adn00562  Inositol phosphate metabolism
adn01100  Metabolic pathways
adn01110  Biosynthesis of secondary metabolites
adn01120  Microbial metabolism in diverse environments
adn01130  Biosynthesis of antibiotics
adn01200  Carbon metabolism
adn01230  Biosynthesis of amino acids
Module
adn_M00002  Glycolysis, core module involving three-carbon compounds
adn_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:adn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Alide_1044
   00051 Fructose and mannose metabolism
    Alide_1044
   00562 Inositol phosphate metabolism
    Alide_1044
Enzymes [BR:adn01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Alide_1044
Exosome [BR:adn04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Alide_1044
  Exosomal proteins of bladder cancer cells
   Alide_1044
  Exosomal proteins of melanoma cells
   Alide_1044
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ADU98809
UniProt: E8U1K5
Position
1111861..1112664
Genome map
AA seq 267 aa AA seqDB search
MDDMTQKKKLIAGNWKMNGSLQANAALLQALRDGLGEAACAVAVAVPAPYLAQVQGLVAG
SAIALAAQDVSQHESGAFTGEVSAAMLRDFGTRYVLVGHSERRQYHGETDAVVAAKAQRA
LAAGITPIVCVGETLAEREAGQTEAVVKRQLAAVVQSNGQCISEIVVAYEPVWAIGTGRT
ATPEQAQQVHAVLRAQLAAATERADRVSLLYGGSMNAANAAQLLAQPDIDGGLVGGASLK
AADFLQIIAAAHAIQAQAATELGAEKA
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atggacgacatgactcagaaaaagaaactcattgccggcaactggaagatgaacggcagc
ctgcaggccaacgcggccctgctgcaggcgctgcgcgacgggctcggcgaggccgcctgc
gccgtggccgtggccgtcccggcgccgtacctggcgcaggtgcaggggctggtcgccggc
tcggcgatcgcgcttgccgcccaggacgtgtcgcagcatgagtcgggcgcgttcacggga
gaggtctccgcggccatgctgcgcgacttcggcacgcgctacgtgctcgtggggcactcc
gaacgccgccagtaccacggcgagacagatgccgtggtggcggccaaggcgcagcgcgcg
ctggcggctggcatcacgcccatcgtgtgcgtgggcgagaccctggcggagcgcgaggcg
gggcagacggaggccgtggtcaagcgtcagctggcggcggtggtgcagtccaatggccag
tgcatcagcgaaatcgtggtcgcctacgagcccgtctgggccatcggcacgggccgcacg
gcgacccccgagcaggcccagcaggtgcacgccgtgctgcgcgcccagctggcggcggcg
accgagcgcgccgaccgcgtgtccctgctgtacggtggcagcatgaatgccgccaacgcg
gcgcagctgctggcgcagcccgacatcgacggcggcctggtgggcggggcctcgctcaag
gccgcggattttctgcaaattattgctgcagcgcatgcgatacaagcgcaagcagctacg
gaattaggagctgaaaaagcatga

DBGET integrated database retrieval system