KEGG   Alicycliphilus denitrificans BC: Alide_1599Help
Entry
Alide_1599        CDS       T01397                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
adn  Alicycliphilus denitrificans BC
Pathway
adn00071  Fatty acid degradation
adn00072  Synthesis and degradation of ketone bodies
adn00280  Valine, leucine and isoleucine degradation
adn00310  Lysine degradation
adn00362  Benzoate degradation
adn00380  Tryptophan metabolism
adn00620  Pyruvate metabolism
adn00630  Glyoxylate and dicarboxylate metabolism
adn00640  Propanoate metabolism
adn00650  Butanoate metabolism
adn00900  Terpenoid backbone biosynthesis
adn01100  Metabolic pathways
adn01110  Biosynthesis of secondary metabolites
adn01120  Microbial metabolism in diverse environments
adn01130  Biosynthesis of antibiotics
adn01200  Carbon metabolism
adn01212  Fatty acid metabolism
adn02020  Two-component system
Brite
KEGG Orthology (KO) [BR:adn00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Alide_1599
   00630 Glyoxylate and dicarboxylate metabolism
    Alide_1599
   00640 Propanoate metabolism
    Alide_1599
   00650 Butanoate metabolism
    Alide_1599
  Lipid metabolism
   00071 Fatty acid degradation
    Alide_1599
   00072 Synthesis and degradation of ketone bodies
    Alide_1599
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Alide_1599
   00310 Lysine degradation
    Alide_1599
   00380 Tryptophan metabolism
    Alide_1599
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Alide_1599
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Alide_1599
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Alide_1599
Enzymes [BR:adn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Alide_1599
Exosome [BR:adn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Alide_1599
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N
Motif
Other DBs
NCBI-ProteinID: ADU99355
UniProt: E8TUU6
Position
complement(1670774..1671955)
Genome map
AA seq 393 aa AA seqDB search
MNAMNFHHPAFIVGAFEHPTRHAPDKSVAQLHAECARGALADAGLGMDDVDGYFCAADAP
GGIPALMADYLNLRLRHIDGTESGGCSYIAHVGHAATAIAQGRCSVALITLAGKPRSSGQ
ATGTEIRKIPPERPAAPFEQPYAWTVAGLYGILASRHMYEYGTTMEQLAWVKVAASHHAQ
HNPHALLRKVFTTDDVLASPLVADPLRRLDCCVITDGGGALVMVHPSIARSLKRPMVGVR
GFAETIRTNEAGRLDLLQTGAAVTGPRAFENARLTPADVKYASVYDNFTIMVAMQLEDLG
FCAKGDGGRFVADGNLISGVGRLPWNTDGGGLCNNHPQNRGGITKVIEAVRQLRGEAHPA
VQVPNCDIALASGPGLVMGAGHAHATVLLERLQ
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaacgccatgaattttcatcatcccgccttcatcgtgggcgccttcgagcacccgacg
cgccatgcgccggacaagtcggtggcgcaattgcatgccgaatgcgcgcgcggcgcgctg
gccgacgccgggctgggcatggacgacgtggacggctatttctgcgccgccgatgcgcca
ggcggcatccccgccctgatggccgactacctgaatctgcgcctgcggcacatcgacggc
acggagtccggcggctgctcgtacatcgcgcacgtaggccatgccgccacggccatcgca
cagggcaggtgctccgtggccctcatcacgctggccggcaagccgcgcagcagcggccag
gcgaccggcaccgagatccgcaagattcccccggagcgccccgccgcgcccttcgagcag
ccctacgcatggacggtcgccggcctgtacggcatcctggccagccggcacatgtacgaa
tacggcacgacgatggagcagctggcctgggtcaaggtcgctgcgtcgcaccatgcccag
cacaacccccatgcgctgcttcgcaaggtattcaccacggacgacgtgctggcctccccc
ctcgtggccgatccgctgcggcggctggattgctgcgtgatcaccgacggcgggggcgcg
ctggtgatggtccacccctccattgcgcggtcgctcaagcgccccatggtcggcgtgcgc
gggttcgcggaaaccatccgcaccaacgaggccgggcgcctcgacctgctgcagaccggt
gccgcagtcaccggcccgcgcgccttcgagaacgcccgcctcacgcccgcggacgtgaag
tacgcctcggtctacgacaacttcaccatcatggtggccatgcagctcgaagacctgggc
ttctgcgccaagggcgatggcggccgcttcgtcgccgacggcaacctcatctcgggcgtt
ggcaggctgccctggaacacggacggcggcggcctgtgcaacaaccacccgcagaaccgc
ggcggcatcaccaaggtcatcgaggccgtgcgccagctgcgcggagaagcccatcctgcc
gtgcaggtcccgaactgcgacatcgccctggccagcggcccgggcctcgtcatgggcgcg
ggccatgcacacgccacggtattgctggagcgcctgcaatga

DBGET integrated database retrieval system