KEGG   Alicycliphilus denitrificans BC: Alide_1880Help
Entry
Alide_1880        CDS       T01397                                 

Definition
(GenBank) Glutaminase, core
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
adn  Alicycliphilus denitrificans BC
Pathway
adn00220  Arginine biosynthesis
adn00250  Alanine, aspartate and glutamate metabolism
adn00471  D-Glutamine and D-glutamate metabolism
adn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:adn00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Alide_1880
   00220 Arginine biosynthesis
    Alide_1880
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Alide_1880
Enzymes [BR:adn01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     Alide_1880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase
Motif
Other DBs
NCBI-ProteinID: ADU99624
UniProt: E8TXG9
Position
complement(1935751..1936677)
Genome map
AA seq 308 aa AA seqDB search
MGHAALETLQGFLVGLDARMKRAHKRGRVAHYIPQLASVDVHQFGISVCLASGERLSAGD
AATPFSIQSISKVFSLAIALGRHGDRLWKRVGNEPSNYTFNSVIELEQEGGKPRNPFVNA
GALVTTDAMLDAPDAGCGLDELMDFVRTAAGDDRISIDEQVAASEYRTAYRNFSLAYFLR
SCGNLHMECERLLQIYCRQCAITMNCEQLASAGRFLAGFDSAAHLLNPAQARSINALMLL
AGHYDGSGDFAYSVGFPGKSGVGGGILAVVPGHASIAVWSPGLNAFGNSLLGTRALQELS
EFTGWSVF
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgggccacgccgctttggaaacgctccagggctttctggtagggctcgacgcgcgcatg
aagcgcgcacacaagcgcggccgggtggcgcactacattccgcaactggccagcgttgat
gtgcatcagttcgggatcagtgtgtgcctggccagcggagagcggctgagcgcgggcgac
gctgcgacgccgttttcgatccagagcatctcaaaggtcttctcactggcgatcgcattg
ggccgtcacggcgaccggctctggaagcgggtgggcaatgaaccatctaactacaccttc
aactcggtcatcgagcttgagcaggaaggcggcaaaccgcgcaatcctttcgtcaatgcg
ggcgcactggtcaccaccgacgccatgctcgatgcgcctgacgcaggctgcggactcgac
gaactgatggatttcgttcgcacggcggctggagatgaccggatctcgattgatgaacag
gttgccgcctcggaataccggacggcctaccgcaacttctctctggcgtactttctacgc
tcgtgcggcaatctgcacatggaatgcgaacgtctgctgcagatttactgtcgccaatgc
gcgatcacgatgaactgcgagcaattggccagcgccggccggttcctggccggcttcgac
tccgcagcccacctgctgaacccagctcaggcacgcagcatcaacgccttgatgttgctc
gcggggcactatgatggttcaggcgactttgcctattcggtcggcttccccggcaagagt
ggcgtcggaggcggcattctggcggtcgttccgggacatgcatcgatcgcggtctggtct
cctggcctgaatgcgtttggcaattcactgctcggcacgcgcgcgctgcaggagttatcg
gagttcaccggctggtcggtgttctga

DBGET integrated database retrieval system