KEGG   Alicycliphilus denitrificans BC: Alide_2270Help
Entry
Alide_2270        CDS       T01397                                 

Definition
(GenBank) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
adn  Alicycliphilus denitrificans BC
Pathway
adn00300  Lysine biosynthesis
adn01100  Metabolic pathways
adn01120  Microbial metabolism in diverse environments
adn01230  Biosynthesis of amino acids
Module
adn_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:adn00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Alide_2270
Enzymes [BR:adn01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Alide_2270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: ADV00006
UniProt: E8U168
Position
complement(2326688..2327866)
Genome map
AA seq 392 aa AA seqDB search
MPSPTLLLTEQLIARPSVTPEDAGCLDLLAERLAPLGFACERLDSGPSSFRVCNLWAKRA
ATPTSQSQAAIKTVVFAGHTDVVPTGPVEQWSSAPFTPTQRDGRLYGRGASDMKTSIAAF
VVAVEEFLAATPAPAIAIAFLLTSDEEGPSVDGTKVVVEQLRARGERLDWCIVGEPTSVQ
STGDMIKNGRRGTLSGRLTVRGVQGHIAYPHLARNPIHQAVPALAELAATVWDRGNDFFP
PTSWQMSNIHGGTGATNVIPGEVAIDFNFRFCTESTAESLKERVHAVLDHHGLEYDLAWT
LGGQPFLTTPGELVGAVQQAIHAETGLTTELSTTGGTSDGRFIAQICPQVVELGPPNDSI
HKIDENIRLTDIEPLKNIYRRTLENLNAQAAA
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgccctctcctaccctgctgctgaccgaacagctcatcgcccgcccctccgtcacgccc
gaagacgccggctgcctcgacctgctggccgagcgccttgcgcccctgggcttcgcctgc
gagcggctggacagcggcccgtcctccttccgcgtctgcaacctatgggcaaaaagggcc
gcaacgcccaccagtcaatcgcaggcagctatcaaaacagtagtattcgccggccacacc
gacgtcgtgcccacgggccccgtggagcagtggagcagcgcgccgttcacgcccacgcag
cgcgacggccgcctgtacgggcgcggcgccagcgacatgaagacctccatcgccgccttc
gtcgtggccgtggaggagttcctagccgccacgcccgcgccggccatcgccatcgccttc
ctgctcaccagcgacgaggaaggcccgtcggtagacggcaccaaggtggtcgtcgagcag
ctgcgcgcgcgcggcgagcgcctggactggtgcatcgtgggcgagcccacctccgtgcag
agcacgggcgacatgatcaagaacggccgccgcggcacgctgtcgggcaggctcaccgta
cgcggcgtgcagggccacatcgcctacccgcatctcgcgcgcaaccccatccaccaggcc
gtgcccgcgctggccgagctggccgccaccgtctgggaccgaggcaacgacttcttcccg
ccgaccagctggcagatgagcaacatccacggcggcacgggcgcgaccaacgtgatcccg
ggcgaggtggccatcgacttcaacttccgcttctgcaccgaatccacggccgagagcctg
aaggagcgcgtgcatgcggtgctggaccaccacggcctcgaatacgacctggcctggacg
ctgggcggccaacccttcctgaccacgccgggcgagctggtcggcgccgtgcagcaggcc
atccatgccgagacgggcctgacgaccgagctgtccaccaccggcggcaccagcgacggg
cgcttcatcgcgcagatctgcccgcaggtggtcgagctcggcccgcccaacgacagcatc
cacaagatcgacgagaacatccgcctgacggacatcgagccgctcaagaacatctaccgc
cgcacgctcgaaaacctcaacgcgcaggccgcggcatga

DBGET integrated database retrieval system