KEGG   Alicycliphilus denitrificans BC: Alide_3148Help
Entry
Alide_3148        CDS       T01397                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
adn  Alicycliphilus denitrificans BC
Pathway
adn00260  Glycine, serine and threonine metabolism
adn00400  Phenylalanine, tyrosine and tryptophan biosynthesis
adn01100  Metabolic pathways
adn01110  Biosynthesis of secondary metabolites
adn01130  Biosynthesis of antibiotics
adn01230  Biosynthesis of amino acids
Module
adn_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:adn00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Alide_3148
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Alide_3148
Enzymes [BR:adn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Alide_3148
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB
Motif
Other DBs
NCBI-ProteinID: ADV00870
UniProt: E8TYH2
Position
3283566..3284375
Genome map
AA seq 269 aa AA seqDB search
MSRIADTFAALQEKGRKALIPYVTAGFPFADITPALMHGMVEAGADVIELGVPFSDPMAD
GPVIQKAGEKALSLGIGMPQVLEMVRSFRQRNQTTPVVLMGYANPVERYDQRHGKGAFAR
DAGAAGVDGVLVVDYPPEECEQFAADLRAHGIDLIFLLAPTSTPERMQQVARVASGYVYY
VSLKGVTGSGALDTAAVESMLPRIREHVKIPVGVGFGIRDAATAQAIGRVADAVVIGSRI
IQLIEDQPHEKVVGITVDFLRGIRKALDA
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgagccgcatcgctgacaccttcgccgccctgcaggaaaagggtcgcaaggcgctcatc
ccctacgtgacggcgggcttcccgttcgccgacatcacgcccgcgctcatgcacggcatg
gtggaggccggcgccgacgtgatcgagctcggcgtgcccttctccgaccccatggccgac
ggcccggtgatccagaaggcgggcgagaaggccctgtccctgggcatcggcatgccgcag
gtgctggagatggtgcgcagtttccgccagcgcaaccagaccacgcccgtggtgctcatg
ggctacgccaacccggtggagcgctacgaccagcgccacggcaagggcgcgttcgcccgc
gatgccggcgcggccggcgtggacggcgtgctcgtcgtggactacccgcccgaggaatgc
gagcagttcgccgccgacctgcgcgcacacggcatcgatctgatcttcctgctcgccccc
acctccacgcccgagcgcatgcagcaggtggcgcgcgtggccagcggctacgtgtactac
gtctcgctcaagggcgtgacgggctcgggcgcgctcgacaccgccgccgtcgagtccatg
ctgccgcgcatccgcgagcacgtgaagatccccgtcggcgtgggcttcggcatccgcgac
gcggccacggcccaggccatcggccgcgtggccgacgccgtggtcatcggcagccgcatc
atccagctcatcgaggaccagccgcacgagaaggtggtcggcatcaccgtggacttcctg
cgcggcatccgcaaggcgctcgacgcataa

DBGET integrated database retrieval system