KEGG   Alicycliphilus denitrificans BC: Alide_3281Help
Entry
Alide_3281        CDS       T01397                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
adn  Alicycliphilus denitrificans BC
Pathway
adn00071  Fatty acid degradation
adn00072  Synthesis and degradation of ketone bodies
adn00280  Valine, leucine and isoleucine degradation
adn00310  Lysine degradation
adn00362  Benzoate degradation
adn00380  Tryptophan metabolism
adn00620  Pyruvate metabolism
adn00630  Glyoxylate and dicarboxylate metabolism
adn00640  Propanoate metabolism
adn00650  Butanoate metabolism
adn00900  Terpenoid backbone biosynthesis
adn01100  Metabolic pathways
adn01110  Biosynthesis of secondary metabolites
adn01120  Microbial metabolism in diverse environments
adn01130  Biosynthesis of antibiotics
adn01200  Carbon metabolism
adn01212  Fatty acid metabolism
adn02020  Two-component system
Brite
KEGG Orthology (KO) [BR:adn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Alide_3281
   00630 Glyoxylate and dicarboxylate metabolism
    Alide_3281
   00640 Propanoate metabolism
    Alide_3281
   00650 Butanoate metabolism
    Alide_3281
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Alide_3281
   00072 Synthesis and degradation of ketone bodies
    Alide_3281
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Alide_3281
   00310 Lysine degradation
    Alide_3281
   00380 Tryptophan metabolism
    Alide_3281
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Alide_3281
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Alide_3281
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Alide_3281
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:adn04147]
    Alide_3281
Enzymes [BR:adn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Alide_3281
Exosome [BR:adn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Alide_3281
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C
Motif
Other DBs
NCBI-ProteinID: ADV01003
UniProt: E8U004
Position
complement(3426153..3427337)
Genome map
AA seq 394 aa AA seqDB search
MREAVFVSTARTPLTKAHRGEFNITPGPTLAAFAVRAAVERAGIDPGLIEDVVMGCGNPE
GRMARNIGRQAAIRAGLPLSVAGTTVSRFCASGLQAISEAAGRIVMDGEAALAAGGVESI
SGLKPPAPGAEGGSDPWIVEHKPDLYMAMIDTADVVAQRYGISREAQDRFSLQSQLRTEQ
AQAAGRYRDEIIPVTTQMAVIDKATGAVSQREVTVDRDTCNRAGTTYEALAALEPVKGQG
KFITAGNASQLSDGAAACVMMEGKAAERANLQPLGAFRGFAVAGCEPDEMGIGPVFAVPK
LLARHGLKVEDIGLWELNEAFASQVIYCRDRLGIPDELLNVNGGSIAIGHPFGMTGARLA
GHVLLEGRRRRTKYAVVTMCIAGGMGAAGLFEIF
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgaagccgtcttcgtctccaccgcccgcacgcccttgaccaaggcgcaccgtggc
gagttcaatatcaccccgggccccaccctggcggcgttcgcggtgcgcgcggcggtcgag
cgcgccggtatcgacccgggcctgatcgaggatgtggtcatgggctgcggtaaccccgag
gggcgcatggcgcgcaacatcggccgccaggcggccatccgcgcgggcctgccgttgtcg
gtggccggcactacggtgagccgcttctgcgcctccggcctgcaggccatctccgaggcg
gccggccgcatcgtgatggacggcgaggccgccctggcggctggcggcgtggagagcatc
tccggcctcaagccgcccgcacccggggcagagggcggctctgacccctggatcgtcgag
cacaagcccgacctgtacatggccatgatcgacaccgccgatgtggtggcgcagcgctat
ggcatcagccgcgaggcccaggaccgcttctcgctccagagccagttgcgcaccgagcag
gcgcaggcggcgggccggtaccgtgacgagatcatcccagtgaccacgcagatggcggtg
atcgacaaggccactggcgcggtgagccaacgcgaggtcacggtcgacagggacacctgc
aaccgggctggcaccacctatgaggcactggccgcgctggagccggtcaagggccagggc
aagttcatcaccgccggcaacgcctcgcagctgtctgatggcgccgctgcctgcgtgatg
atggaaggcaaggcggccgaacgcgccaatcttcagcccctgggtgctttccgcggcttc
gcggtggccggctgtgagccggacgagatgggcatcggccctgtgtttgccgtccccaag
ctgctggcgcgccatggcctgaaagttgaggacatcggcctgtgggagctcaatgaggct
ttcgcctcgcaggtgatctactgccgggaccgactcggcatccccgacgagttgctcaat
gtcaacggcggctccatcgctatcggccatcctttcggcatgacgggcgcgcgcctggcc
ggccatgtactgttggaaggccgccgccgccgcaccaagtatgcggttgtcaccatgtgc
attgccggcggcatgggggcggccggcctgttcgagattttctga

DBGET integrated database retrieval system