KEGG   Alicycliphilus denitrificans BC: Alide_3438Help
Entry
Alide_3438        CDS       T01397                                 

Definition
(GenBank) phosphoglycerate mutase 1 family
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
adn  Alicycliphilus denitrificans BC
Pathway
adn00010  Glycolysis / Gluconeogenesis
adn00260  Glycine, serine and threonine metabolism
adn00680  Methane metabolism
adn01100  Metabolic pathways
adn01110  Biosynthesis of secondary metabolites
adn01120  Microbial metabolism in diverse environments
adn01130  Biosynthesis of antibiotics
adn01200  Carbon metabolism
adn01230  Biosynthesis of amino acids
Module
adn_M00002  Glycolysis, core module involving three-carbon compounds
adn_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:adn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Alide_3438
  Energy metabolism
   00680 Methane metabolism
    Alide_3438
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Alide_3438
Enzymes [BR:adn01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Alide_3438
Membrane trafficking [BR:adn04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Alide_3438
Exosome [BR:adn04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Alide_3438
  Exosomal proteins of melanoma cells
   Alide_3438
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ADV01157
UniProt: E8U1A4
Position
3591705..3592448
Genome map
AA seq 247 aa AA seqDB search
MHKLVLIRHGESTWNLENRFTGWTDVDLTETGIEQAKNAGRLLKAEGYEFDLAYTSVLKR
ATRTLWHCLDEMDRTWLPVEHSWRLNERHYGALQGLNKADMAKQYGDAQVLVWRRSYDTP
PPALEPTDPRCERGDIRYAGLAPEQVPLTECLKDTVARVLPYWNEAIAPTIRSGKRVLIA
AHGNSIRALVKYLDGISDQDIVGLNIPNGIPLVYELDAELKPLRSYYLGDAEAAAKAAAA
VAAQGKA
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgcacaaactcgttctgatccgccacggcgaatccacgtggaatctcgaaaaccgtttc
accggctggaccgacgtggatctgaccgaaaccggcatcgaacaggccaagaacgccggc
cgcctgctcaaggccgagggctacgagttcgacctggcctacaccagcgtcctgaagcgc
gccacgcgcacgctgtggcactgtctggacgagatggaccgcacctggctgcccgtggag
cacagctggcgcctgaacgagcgccactacggcgcgctgcagggcctgaacaaggccgac
atggccaagcagtacggcgacgcgcaggtgctggtgtggcgccgcagctacgacacgccg
ccgccggccctggagcccaccgacccgcgctgcgagcgcggcgacatccgctacgcgggc
ctggcgcccgagcaggtgccgctgaccgagtgcctcaaggacacggtggcgcgcgtgctg
ccctactggaacgaagccatcgcgccaacgatccgctcgggcaagcgtgtgctgatcgca
gcgcacggcaactccatccgcgcgctggtcaagtacctggacggcatctccgaccaagac
atcgtggggctgaacatccccaacggcatcccgctggtgtacgagctggacgcggaactc
aagcccctgcgcagctactacctgggcgacgccgaggccgccgccaaggccgccgccgcc
gtggccgcgcagggcaaggcctga

DBGET integrated database retrieval system