KEGG   Altererythrobacter dongtanensis: A6F68_01973Help
Entry
A6F68_01973       CDS       T04466                                 

Gene name
gpx1
Definition
(GenBank) Hydroperoxy fatty acid reductase gpx1
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
ado  Altererythrobacter dongtanensis
Pathway
ado00480  Glutathione metabolism
ado00590  Arachidonic acid metabolism
ado01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ado00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    A6F68_01973 (gpx1)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    A6F68_01973 (gpx1)
Enzymes [BR:ado01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     A6F68_01973 (gpx1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: ANY20481
UniProt: A0A1B2AEF6
Position
1989802..1990281
Genome map
AA seq 159 aa AA seqDB search
MTTIADFTVEKPDGSQLDLSEKLGKVLLVVNVASKCGFTPQYEGLEALQRKYGDKGFEVL
GFPCNQFGAQEPGNAEEIATFCKLTYDVTFPVLKKVEVNGAGASPLYDWMKGEAPGLMGS
RAIKWNFTKFLVDREGNVVRRYGPADAPKGVEKDIEKLL
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgacgaccattgccgatttcaccgtcgagaagcccgacggcagccagctcgatctcagc
gagaaacttggcaaggttctgctggtggtcaacgtggccagcaaatgcggtttcacgccg
cagtacgaaggtctcgaagcgcttcagcgcaagtatggcgacaagggttttgaggtgctc
ggctttccctgcaaccagttcggagcacaggaacccggtaatgccgaagagatcgcaacc
ttctgcaagctgacctacgacgtcacgtttccggtcctcaagaaggtggaagtgaacggg
gcaggggccagtccgctttacgactggatgaaaggcgaggcccccggtctcatgggcagc
cgggccatcaaatggaacttcacgaagtttctggtcgatcgcgaggggaacgtcgtgagg
cgctacggaccggccgacgcgcccaagggagtcgagaaggacatcgagaagctcctttag

DBGET integrated database retrieval system