KEGG   Altererythrobacter dongtanensis: A6F68_02837Help
Entry
A6F68_02837       CDS       T04466                                 

Gene name
pcaF
Definition
(GenBank) Beta-ketoadipyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ado  Altererythrobacter dongtanensis
Pathway
ado00071  Fatty acid degradation
ado00072  Synthesis and degradation of ketone bodies
ado00280  Valine, leucine and isoleucine degradation
ado00310  Lysine degradation
ado00362  Benzoate degradation
ado00380  Tryptophan metabolism
ado00620  Pyruvate metabolism
ado00630  Glyoxylate and dicarboxylate metabolism
ado00640  Propanoate metabolism
ado00650  Butanoate metabolism
ado00900  Terpenoid backbone biosynthesis
ado01100  Metabolic pathways
ado01110  Biosynthesis of secondary metabolites
ado01120  Microbial metabolism in diverse environments
ado01130  Biosynthesis of antibiotics
ado01200  Carbon metabolism
ado01212  Fatty acid metabolism
ado02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ado00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    A6F68_02837 (pcaF)
   00630 Glyoxylate and dicarboxylate metabolism
    A6F68_02837 (pcaF)
   00640 Propanoate metabolism
    A6F68_02837 (pcaF)
   00650 Butanoate metabolism
    A6F68_02837 (pcaF)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    A6F68_02837 (pcaF)
   00072 Synthesis and degradation of ketone bodies
    A6F68_02837 (pcaF)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    A6F68_02837 (pcaF)
   00310 Lysine degradation
    A6F68_02837 (pcaF)
   00380 Tryptophan metabolism
    A6F68_02837 (pcaF)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    A6F68_02837 (pcaF)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    A6F68_02837 (pcaF)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    A6F68_02837 (pcaF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ado04147]
    A6F68_02837 (pcaF)
Enzymes [BR:ado01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     A6F68_02837 (pcaF)
Exosome [BR:ado04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   A6F68_02837 (pcaF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ANY21326
UniProt: A0A1B2AGQ0
Position
complement(2874177..2875349)
Genome map
AA seq 390 aa AA seqDB search
MPTAYIIDAVRTAGGRRGGRLSGVHPVDLAATTLDALVARTGIDPAKVDDVVMGCVTQAG
EQAMQVGRMAVLASKLLPQSCPAVTIDRQCGSSQQAIQFAAQAVMSWTQDAVIAAGVESM
TRVPMGTNLTLHMKEGMGHYKSPGLEARFPGVMFSQFAGAEMIADKWGMTKDEIDRFAYD
SHRKAIAATEAGAFAREIVPVTVETPEGNVEHVVDEGIRFDATLEGIAAVKLLKEGGKIT
AASSSQICDGASAALIVSEQALKDYGLTPRARIHTLTVTAGDPVIMLEEPLFATDKALAR
AGLTIGDIDLYEVNEAFAPVPMAWLKHTGADPDKLNVNGGAIALGHPLGASGTKLMATLL
NVLHSRGGKYGLQTMCEGGGVANVTIIEAV
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgcccacagcctacatcatcgacgccgttcgcaccgcaggagggcgccgtggcgggcgg
ttgtcgggagtgcatccggtcgacctggcggcgaccacgctcgatgcgctggttgcccgc
accggcatcgatccggccaaggtcgacgatgtcgtcatgggctgcgtcacccaggcgggc
gagcaggccatgcaggtcgggcgcatggcggtgctggccagcaagctgctgccgcaatcg
tgtccggcagtcacgatcgatcgccagtgcggctcgtcgcagcaggcgatccagttcgcc
gcgcaggcggtcatgagttggacccaggacgcggtcatcgcggcgggcgtcgagagcatg
acgcgtgtgccgatgggcaccaacctgaccctgcacatgaaggagggcatgggccactac
aagtcgcccggcctcgaggcgcggtttcccggtgtgatgttctctcagttcgccggtgcc
gagatgatcgccgacaagtgggggatgacgaaggacgagatcgaccgcttcgcctacgac
agtcaccgaaaggcgatcgcggcgaccgaagcgggcgcgttcgcgcgcgaaatcgtcccc
gtgaccgtcgagacccccgaggggaacgtcgagcacgtggtcgacgaaggtatccggttc
gacgcgacgctcgaaggtatcgcggcggtcaagctcctcaaggaggggggcaagatcacc
gcggcaagttccagccagatttgcgacggcgcaagcgcggcgctcatcgtgtcggaacag
gcgctcaaggattacggtctcaccccgcgggcgcgcatccacacgctgacggtcaccgcg
ggcgatccggtcatcatgctcgaggaaccgctgttcgcgaccgacaaggcgctggcccgt
gcaggcctgacgatcggcgacatcgatctctacgaagtcaacgaggcattcgcgccggtg
ccgatggcctggctgaagcacaccggcgccgatcccgacaagctcaacgtcaatggaggc
gcgatcgccctcggccacccgctcggggcgagcgggaccaagttgatggccaccttgctg
aatgtgcttcactcgcgcgggggcaaatacggccttcagacgatgtgcgaaggtggcggt
gtcgccaacgtcacgatcatcgaggcggtctag

DBGET integrated database retrieval system