KEGG   Achromobacter denitrificans: APT56_03140Help
Entry
APT56_03140       CDS       T04244                                 

Definition
(GenBank) glutamate-1-semialdehyde aminotransferase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
adt  Achromobacter denitrificans
Pathway
adt00860  Porphyrin and chlorophyll metabolism
adt01100  Metabolic pathways
adt01110  Biosynthesis of secondary metabolites
adt01120  Microbial metabolism in diverse environments
Module
adt_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:adt00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    APT56_03140
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:adt01007]
    APT56_03140
Enzymes [BR:adt01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     APT56_03140
Amino acid related enzymes [BR:adt01007]
 Aminotransferase (transaminase)
  Class III
   APT56_03140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ALX82249
Position
complement(717061..718338)
Genome map
AA seq 425 aa AA seqDB search
MSRNAQLFERASRSIPGGVNSPVRAFRSVGGTPRFIKRAQGPYVWDAEDKQYIDYVGSWG
PAILGHSHPEVVRAVQEAAVNGLSFGAPTEAEIELAEVLIARLPSLEQVRLVSSGTEATM
TAIRLARGATGRNKIVKFEGCYHGHSDSLLVKAGSGLLTFGNPSSAGVPPEFVSHTLTLE
YNNLDAVREAFAQHGADIACIIVEPIAGNMNLIKPAAGFLEGLREVCTQHGALLIFDEVM
TGFRVGPQGVQGLSGVKPDLTTLAKVIGGGMPVGAFGGSAEIMKHIAPLGGVYQAGTLSG
NPVAVAAGLATLRLIAAPGFYDKLAAQTAKLAQGLQERARAAGLAFSADSVGGMFGIYFS
DKVPATFAEVSACDTARFNRFFHAMLDHGVHFAPSAFEAGFVSATHDDAVIQSTLDIAEK
VFAAI
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgtaacgcccagcttttcgaacgcgccagccgcagcatccccggcggcgtcaac
tcgcccgtgcgcgccttccgctccgtgggcggcacgccgcgcttcatcaagcgcgcgcag
gggccgtacgtgtgggatgcggaagacaagcagtacatcgactacgtcggttcgtggggc
ccggccatcctgggccactcgcatcccgaggtggtgcgcgcggtgcaggaggcggccgtc
aacggcctgtcgttcggcgctcccaccgaggccgagatcgaactggccgaagtgctgatc
gcgcgcctgccgtcgctggaacaggtgcgcctggtcagctccggcaccgaagccaccatg
acggccatccgcctggcgcgcggcgccaccggccgcaacaagatcgtcaagttcgaaggc
tgctaccacggccattccgacagcctgctggtcaaggccggctcgggcctgctgaccttc
ggcaaccccagctcggccggcgtgccgcccgaattcgtctcgcacacgctgaccctggaa
tacaacaacctggacgcggtgcgcgaggccttcgcccagcacggcgccgacatcgcctgc
atcatcgtcgagccgatcgccggcaacatgaacctgatcaagccggctgccggcttcctg
gaagggctgcgcgaggtctgcacgcagcacggtgcgctgctgatcttcgacgaggtcatg
accggtttccgcgtcggcccgcagggcgtgcagggtctgtcgggcgtcaagcccgacctg
accacgctggccaaggtgatcggcggcggcatgccggtgggcgccttcggcggcagcgcc
gagatcatgaagcacatcgcgccgctgggcggcgtctaccaggcgggcacgctgtcgggc
aacccggtggccgtggccgccggcctggccacgctgcgcctgatcgccgcccccggtttc
tacgacaagctggcggcgcagaccgccaagctggcccagggcctgcaggaacgcgcccgc
gccgccggcctggccttctcggccgactcggttggcggcatgttcggcatctatttcagc
gacaaggtgccggccacgttcgccgaggtctcggcctgcgacacggcgcgcttcaaccgc
ttcttccacgccatgctggaccacggcgtgcatttcgcgccgtcggcgttcgaggccggc
ttcgtctcggccacccacgacgacgcggtgatccagtccacgctggatatcgccgagaag
gtcttcgcggcgatctga

DBGET integrated database retrieval system