KEGG   Achromobacter denitrificans: APT56_06965Help
Entry
APT56_06965       CDS       T04244                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
adt  Achromobacter denitrificans
Pathway
adt00260  Glycine, serine and threonine metabolism
adt01100  Metabolic pathways
adt01110  Biosynthesis of secondary metabolites
adt01120  Microbial metabolism in diverse environments
adt01130  Biosynthesis of antibiotics
adt01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:adt00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    APT56_06965
Enzymes [BR:adt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     APT56_06965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase BAT Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: ALX82931
Position
1556886..1557896
Genome map
AA seq 336 aa AA seqDB search
MIDLRSDTVTRPSPAMLQAMVSAPLGDDVMGDDPTVIQLQQAVAERAGKAAGLFFPSGTQ
SNLAGLMAHCERGDEYLVGQQAHTYKYEGGGAAVLGSIQPQPIEHAEDGTLPLEKLAAAL
KPEGDPHFARTRLLALENTFHGKLIPADYVRAATDWARGHGLATHLDGARVFNAAVASGK
PLAELCAPFDSVSICFSKGLGAPVGSVLVGSEELIARARRWRKVLGGGLRQSGVLAAACL
YALEHNVERLAEDHANARLLADGLRAIAGVRVLSQDTNMVFAEFEPARCEALTAALAADG
ILMRAVYGGPTRMVTHLDVSRDDVRRVVEAVARHLA
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgatcgatttgcgcagcgataccgttacccggccgtccccggccatgttgcaggccatg
gtcagcgcgccgttgggcgatgatgtgatgggggatgaccccaccgtcatccagctgcag
caagccgtcgccgaacgtgccggcaaggccgccgggctgttctttccgtcgggcacacag
agcaatctggccggcctgatggcgcactgcgagcgtggcgatgagtatcttgtgggtcag
caggcgcatacctacaagtacgaaggcggcggcgcggcggtgctgggcagcatccagccc
caacccatcgaacacgccgaggatggcacgctgccgttggaaaagctggcggcggcgctc
aagcccgaaggggatccgcacttcgctcgcacccgtctgctggcgttggaaaacacgttc
catggcaagctgatcccggccgactacgtgcgcgcggcgaccgactgggcccgcggccat
ggcctggccacgcacctggatggcgcgcgcgtgttcaacgccgccgtggcaagtggcaag
ccgctggccgaactgtgcgcgccgttcgattcggtgtcgatctgcttttccaagggcctg
ggcgcgccggtcggttcggtgctggtgggtagcgaggaactgatcgcccgcgcgcgccgc
tggcgcaaggtgctgggcggcggcctgcgccaatccggcgtgctggcggcggcctgcctg
tatgcgctggaacataacgtcgagcgcctggccgaagaccacgccaacgcgcgcctgctg
gccgacggcctgcgcgccatcgccggcgtgcgggtgttgagccaggacaccaatatggtg
ttcgcggagttcgagccggcacggtgcgaggccctgaccgccgcgttggcggccgacggc
atcctgatgcgcgctgtctatggcggcccgacccgcatggtgacgcacctggacgtgtcg
cgcgacgacgtgcgccgggtggtcgaggccgtggcgcgccatctggcctga

DBGET integrated database retrieval system