KEGG   Achromobacter denitrificans: APT56_07595Help
Entry
APT56_07595       CDS       T04244                                 

Definition
(GenBank) ADP-L-glycero-D-mannoheptose-6-epimerase
  KO
K03274  ADP-L-glycero-D-manno-heptose 6-epimerase [EC:5.1.3.20]
Organism
adt  Achromobacter denitrificans
Pathway
adt00540  Lipopolysaccharide biosynthesis
adt01100  Metabolic pathways
Module
adt_M00064  ADP-L-glycero-D-manno-heptose biosynthesis
Brite
KEGG Orthology (KO) [BR:adt00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    APT56_07595
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:adt01005]
    APT56_07595
Enzymes [BR:adt01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.20  ADP-glyceromanno-heptose 6-epimerase
     APT56_07595
Lipopolysaccharide biosynthesis proteins [BR:adt01005]
 Unusual sugar
  APT56_07595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd RmlD_sub_bind 3Beta_HSD NAD_binding_4 Polysacc_synt_2
Motif
Other DBs
NCBI-ProteinID: ALX83043
Position
1716618..1717607
Genome map
AA seq 329 aa AA seqDB search
MIVVTGAAGFIGSNLVRGLNRRGIEDIIAVDDLTEGDKFVNLVDCKIADYLDKDDFRRRV
ADGSLPQIRAVLHQGACSDTTERNGRYMLDNNYRVTLELFEFCQARRIPFLYASSAAVYG
GSSVYVEDPANEGPLNVYGYSKLLFDQVLRKRMDSLTAQVVGLRYFNVYGPHEQHKGRMA
SVAFHNMNQFLEHGHVRLFAGWDGYVDGGQSRDFISVEDVVAVNLHFLDHPEQSGIFNCG
TGRAQPFNDVAAAVVNTLRAERGEAQLTLAQLVELDLIRYIPFPDDLKGRYQSYTQADVT
RLRAAGFKAPMRDVQTGVSEYVRYWRARK
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgatcgttgttaccggagccgcgggcttcattggcagcaacctggtgcgcggcctgaac
cgccgcgggatcgaagacatcatcgcggtcgatgacctgaccgagggcgacaagttcgtc
aatcttgtggactgcaagatcgccgactacctggacaaggacgactttcgccgccgcgtc
gccgatggcagcctgccgcagatccgcgccgttttgcatcagggcgcctgctcggacacc
accgagcgcaatggccgctacatgctcgacaacaactaccgcgtcacgctggagctgttc
gagttctgtcaggcgcgccgcattcctttcctgtatgcctcgtcggccgcggtctacggc
ggctcctcggtctacgtggaagacccggccaatgaaggtccgctgaatgtctacggctat
tcgaaactgctgttcgaccaggtgctgcgcaagcgcatggacagcctgaccgcgcaggtc
gtgggcctgcgctatttcaacgtttacggcccgcacgagcagcacaagggccgcatggcc
tcggtggctttccacaacatgaaccagttcctggaacatggccacgtgcgcctgttcgcc
ggctgggacggctatgtggatggcggccagagccgcgacttcatttcggtggaggatgtg
gtggcggtgaatctgcatttcctcgaccatcccgaacaatcgggcatcttcaattgcggc
acgggccgcgcccagccgttcaatgacgtcgcggcggccgtggtcaataccctgcgcgcc
gaacgcggcgaagcgcaattgacgctggcacaactggtggagctggacctgatccgctac
atcccgttccccgacgatctgaaagggcggtaccagagctacacgcaggccgacgtcacc
cgcctgcgcgcggccggcttcaaggcgcccatgcgcgatgtgcagaccggcgtgtccgag
tacgtgcgttattggcgcgcccgcaagtaa

DBGET integrated database retrieval system