KEGG   Achromobacter denitrificans: APT56_09955Help
Entry
APT56_09955       CDS       T04244                                 

Definition
(GenBank) coproporphyrinogen III oxidase
  KO
K02495  oxygen-independent coproporphyrinogen III oxidase [EC:1.3.98.3]
Organism
adt  Achromobacter denitrificans
Pathway
adt00860  Porphyrin and chlorophyll metabolism
adt01100  Metabolic pathways
adt01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:adt00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    APT56_09955
Enzymes [BR:adt01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.98  With other, known, physiological acceptors
    1.3.98.3  coproporphyrinogen dehydrogenase
     APT56_09955
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM HemN_C DUF3014 phiKZ_IP
Motif
Other DBs
NCBI-ProteinID: ALX86841
Position
2235673..2237028
Genome map
AA seq 451 aa AA seqDB search
MLARLDKNGPRYTSYPTADRYSGDFDAEQYRQALRQRRASCTSEPLSLYVHIPFCDSVCY
YCACNKVVTRHHDRAARYLDALAREIALHVAELGQGVPVSQLHFGGGTPTFLSDEELDRL
MADLRGAFRFEPDAEISIEVDPRTATPQRLEKLRKLGFNRLSFGVQDFDARVQVAVHRVQ
SFEEVRDLMQSARALGYASVNVDLIYGLPLQTTESFARTIAQVSALRPDRIALYAYAHLP
ERFKPQRRINVADLPDRATRVGLLSAAIEGFLKQGYTYIGMDHFALNTDALAIAKQRGEL
HRNFQGYSTQPDRDLVALGVSAIGRIGDTYSQNAKDLDAYYAAIESGRFAVERGLALSAD
DLARRDVIMDIMCQGKVDFARVEARHGLRFGDYFGPELSQAANLAELGLVNLRAGELRVT
GLGWYFVRAVAMTFDGYLRTVSTGASYSRII
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
ctgctggctcgcttggacaagaacggaccccgctacacctcctatcccacggccgaccgc
tatagcggcgatttcgacgccgagcaatatcggcaggccctgcgccagcggcgcgcttcc
tgtacctcggagcctctgtcgctctacgtacatatcccgttctgcgattcggtctgctat
tactgcgcctgtaataaggtcgtgacccgccatcatgaccgcgccgcccgctacctcgat
gcgctggcgcgcgaaatcgcgctgcacgtggccgaactggggcagggcgtgccggtatcg
caactgcatttcggtggcggcaccccgaccttcctgtccgacgaggagctcgaccgcctc
atggcggatctgcgcggcgccttccgtttcgaacccgacgccgagatttccatcgaagtg
gatccgcgtaccgccacgccgcagcgcctcgaaaagctgcgcaagctgggcttcaatcgt
ctcagtttcggtgtgcaggatttcgatgcgcgggtacaggtggcggtccatcgcgtacag
tccttcgaagaggtccgcgacctgatgcaaagcgcccgggcgctcggctacgcctcggtc
aacgtcgacctgatctacggcctgcctctgcagaccacggaatcgttcgcgcgcaccatc
gcccaggtcagcgcactgcggcccgaccgcatcgcgctctatgcctacgcccacctgccg
gaacgcttcaagccgcaacgtcgcatcaatgtggcggacctgccggaccgcgccacccgg
gtcggcctgctcagcgccgccatcgaaggttttctgaagcagggctacacctacattggc
atggatcatttcgcgttgaacaccgacgccctggccatcgccaagcagcgcggggaactg
catcgcaatttccagggctacagcacccagcccgaccgcgacctggtcgcgctgggggtg
tcggccatcggtcgcatcggcgatacctacagccagaacgccaaggacctggacgcctac
tacgccgccatcgagtccggccgtttcgcggtcgagcgcggactggcgctcagcgccgac
gatctggcgcggcgtgacgtcatcatggacatcatgtgccagggcaaggtggacttcgcc
cgcgtcgaggcgcgccatggcttgcggtttggtgattatttcgggccggagttgtcgcag
gcggccaacctggccgagctgggtctggtcaacctgcgcgcgggcgagctgcgggtcacc
ggcttgggttggtatttcgtcagggccgttgccatgacgttcgatggctatttgcgcacg
gtcagcaccggcgccagctactcgcgcatcatctga

DBGET integrated database retrieval system