KEGG   Achromobacter denitrificans: APT56_18165Help
Entry
APT56_18165       CDS       T04244                                 

Gene name
putA
Definition
(GenBank) trifunctional transcriptional regulator/proline dehydrogenase/L-glutamate gamma-semialdehyde dehydrogenase
  KO
K13821  RHH-type transcriptional regulator, proline utilization regulon repressor / proline dehydrogenase / delta 1-pyrroline-5-carboxylate dehydrogenase [EC:1.5.5.2 1.2.1.88]
Organism
adt  Achromobacter denitrificans
Pathway
adt00250  Alanine, aspartate and glutamate metabolism
adt00330  Arginine and proline metabolism
adt01100  Metabolic pathways
adt01110  Biosynthesis of secondary metabolites
adt01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:adt00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    APT56_18165 (putA)
   00330 Arginine and proline metabolism
    APT56_18165 (putA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:adt03000]
    APT56_18165 (putA)
Enzymes [BR:adt01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     APT56_18165 (putA)
  1.5  Acting on the CH-NH group of donors
   1.5.5  With a quinone or similar compound as acceptor
    1.5.5.2  proline dehydrogenase
     APT56_18165 (putA)
Transcription factors [BR:adt03000]
 Prokaryotic Type
  Ribbon-helix-helix
   Other families
    APT56_18165 (putA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Pro_dh Pro_dh-DNA_bdg PRODH
Motif
Other DBs
NCBI-ProteinID: ALX84960
Position
complement(4071942..4075763)
Genome map
AA seq 1273 aa AA seqDB search
MASTTLGVKVDDALRDRLKAAAQKLNCTPHWLHKQAILAYLDKIERGHLPAEMSHLGGEE
GGDEESGEQQAAATPPFYEFGQDVQPQSVLRAAITAAYRRPEPECVPLLLGQARMPNLEK
VHAMATDLVKKLRGKRTGGGVEGLIQEFSLSSQEGVALMCLAEALLRIPDRATRDALIRD
KVARGDWKSHMGGSQSLFVNAATWGLMITGKLVAVSSEQSLSKALTRLIGKGGEPLVRKG
VNIAMRMMGEQFVSGQTISEALANNRKMESRGFRYSYDMLGEAATTAEDADRYYASYEQA
IHAIGKAAAGRGIYEGPGISIKLSALHPRYSRAQRERVMAELLPRVKALTILARSYDIGL
NIDAEEADRLEISLDLLEALCFTPELEGWNGIGFVIQAYQKRAPFVIDYVIDLARRSRHR
VMVRLVKGAYWDSEIKRAQVDGLEGYPVYTRKVYTDVAYLACARKLLGAPEAVYPQFATH
NAYTLSAIYQLAGQNYYPGQYEFQCLHGMGEPLYDEVVGPLAQGKLNRPCRIYAPVGTHE
TLLAYLVRRLLENGANTSFVNLIGDESIPVETLVADPVEAASRIVPLGAPHEKIPLPREL
YGSAQQGARANSAGLDLSNEHRLGSLSAALLTSAATPWRAGPMLGEGDGAWDAARAIEVR
NPANLRDVVGHVIEANGEEAEAALRAAANAAPIWQSTPVAERAQCLRRAAQLLEEQMQTL
LGLIVREAGKSLPNAIAEVREAVDFLRYYADQADREFSNDTHRPLGTVLCISPWNFPLAI
FTGQVAAALAAGNTVLAKPAEQTPLIAAQAVAILRAAGVPAGAVQLLPGRGETVGAQLVA
SPGVRGVMFTGSTDVARIIARTLADRLDDDGHTIPLIAETGGQNAMVVDSSALAEQVVFD
VLSSAFDSAGQRCSALRVLCVQEDNADHVLTMLRGAMRELSVGNPDRLSVDVGPVIDTEA
RNNIQRHIDAMRTAGHRVDQVELNGECRHGTFVAPTIIEIDHISELTREVFGPVLHVVRY
ARDELDGLLDAINGTGYGLTFGVHTRIDETIAHVTGQVHAGNVYVNRNIVGAVVGVQPFG
GECLSGTGPKAGGPLYMYRLLGTRPEGLPPALDAAAPLPQRIALPGPTGETNTYMVEPRG
AVYCVAATEAGARAQWAAARLTGNHAWFADTPAAHALLATLDAEQQGQAGILADAEVDQA
DYHAVLFEGDGDTLRALNQRIAQRPGAILAVHGLTSDALAAGAAYVPERLLTERSISVNT
AAAGGNASLMTIG
NT seq 3822 nt NT seq  +upstreamnt  +downstreamnt
atggccagcaccaccctcggcgtcaaggtcgatgacgcgctacgcgaccgcctgaaggcc
gccgcgcaaaaactcaattgcacgccgcactggctgcacaagcaggcgatccttgcctac
ctggacaagatcgagcgcggccacctgcccgccgaaatgtcccacctgggcggggaagag
gggggcgacgaagagagcggcgagcagcaagccgccgccacgccgccgttctacgaattc
ggccaggacgtgcaaccgcaatcggtgctgcgcgccgccattaccgccgcctaccgccgc
cccgagccggaatgcgtgccgctgctgctgggccaggcgcgcatgcccaacctggaaaaa
gtgcatgcgatggccactgacctggtcaagaagctgcgcggcaagcgcaccggcggcggg
gtggaagggctgatccaggaattctcgctgtcgagccaggaaggcgtggcgctgatgtgc
ctggccgaggcgctgctgcgcattcccgaccgcgccacgcgcgacgcgctgatccgcgac
aaggtcgcgcgcggcgactggaagtcgcacatgggcggctcgcaatcgttgttcgtcaac
gccgccacctggggcctgatgatcaccggcaagctggtggccgtgagcagcgagcagtcg
ctgtccaaggcgctgacgcgcctgattggcaagggcggcgaaccgctggtgcgcaagggc
gtgaacatcgccatgcgcatgatgggcgagcagttcgtgtcgggccagaccatttccgag
gcgctggccaacaaccgcaagatggaaagccgcggcttccgctattcgtacgacatgctg
ggggaagcggctaccacggccgaggacgccgaccgctattacgcctcgtacgaacaggcc
atccatgccattggcaaggccgccgccggccgcggcatctatgaaggccccggcatctcc
atcaagctgtcggcgctgcatccgcgctattcgcgcgcccagcgcgaacgcgtcatggcc
gagctgctgccgcgcgtgaaggcgctgaccatcctggcgcgcagctacgacatcggcctg
aacatcgatgccgaggaagccgaccgcctggagatttcgctggatctgctggaggcgctg
tgcttcacgcccgagctggagggctggaacggcatcggctttgtcatccaggcctaccag
aagcgcgcgccattcgtgatcgactacgtgatcgacctggcccgccgcagccgtcatcgc
gtgatggtgcgcctggtcaagggcgcctactgggacagcgagatcaagcgcgcccaggtc
gacggcctggagggctatccggtctacacccgcaaggtctacaccgacgtggcctacctg
gcctgcgcccgcaagctgctgggcgcgccggaagccgtgtacccgcagttcgccacccac
aacgcctacacgctgtcggcgatctaccaactggccggccagaactactacccgggccag
tatgaattccagtgcctgcatggcatgggcgagccgctgtacgacgaagtggtcggaccg
ctggcgcagggcaagctgaaccgcccctgccgcatctacgcgccggtcggcacgcacgaa
acgctgctggcctacctggtgcgccgcctgctggaaaacggcgccaacacctcgttcgtc
aacctgatcggcgacgagagcatcccggtcgagacgctggtggccgatccggtcgaggcc
gcctcgcgcatcgtgccgctgggcgcgccgcacgagaagatcccgctgccgcgcgagttg
tacggcagcgcgcagcagggcgcgcgcgccaactccgccggcctggacctgagcaacgaa
catcgcctgggctcgttgtcggccgcgctgctgaccagcgccgccacgccctggcgcgcc
ggtccgatgctgggcgaaggcgacggcgcctgggacgcggcgcgcgccatcgaggtgcgc
aatcccgccaacctgcgcgacgtggtcggccatgtcatcgaagccaatggcgaggaagcc
gaggccgccctgcgcgccgccgccaatgccgcgcccatctggcaatcgaccccggtggcc
gagcgcgcgcaatgcctgcgccgcgccgcgcaattgctggaggagcagatgcagaccctg
ctgggcctgatcgtgcgcgaggccggcaagtcgctgcccaacgccatcgccgaagtgcgc
gaggcggtggacttcctgcgctactacgccgaccaggccgaccgcgaattcagcaacgac
acccatcgtccgctcgggacggtgctgtgcatcagcccctggaatttcccgctggccatt
ttcaccggccaggtcgcggccgcgctggcggccggcaataccgtgctggccaagcccgcc
gagcagacgccgctgatcgcggcgcaggcggtggcgatcctgcgcgccgccggcgtgccg
gctggcgccgtccaactgctgcccggccgcggcgaaaccgtgggcgcgcaactggtggcc
agccctggcgtgcgcggcgtgatgttcactggctcgaccgacgtggcgcgcatcatcgcg
cgcacgctggccgaccgcctggacgacgacggccacaccattccgctgatcgccgagacc
ggcggccagaacgccatggtggtcgactcgtcggcgttggccgagcaggtggtgttcgac
gtgctcagctcggccttcgattcggccggccagcgctgttccgcgctgcgcgtgctgtgc
gtgcaggaagacaatgccgatcacgtcctgaccatgctgcgcggcgccatgcgcgagctc
agcgtgggcaatcccgaccgcctgtcggtcgacgtcggcccggtcatcgatacggaggcg
cgcaacaatatccagcgccacatcgatgcgatgcgcacggccggccaccgcgtggaccag
gtcgaactgaatggcgaatgccgccacggcaccttcgtggcgcccaccatcatcgagatc
gaccacatcagcgagctgacgcgcgaggtgttcggtccggtactgcacgtggtgcgctac
gcccgcgacgaactggacgggctgctggacgccatcaacggcaccggctatggcctgacc
ttcggcgtgcatacccgcatcgacgagaccatcgcccacgtgacgggacaggtccatgcc
ggcaatgtctacgtcaaccgcaacatcgtcggcgcggtggtcggcgtgcagccgttcggc
ggcgagtgcctgtcgggcaccggtcccaaggctggcggcccgctatatatgtaccgcctg
ctgggcacgcgccccgaggggttgccgccggcgctggacgcggccgcgccgttgccgcag
cgcattgcattgccgggtcccacgggcgagaccaacacttatatggtcgagccgcgcggc
gcggtctattgtgtggcggccacggaggccggcgcgcgtgcccaatgggcggcggcgcgg
ctgaccggcaaccacgcctggttcgccgacacgccggcggcgcacgcgctgctggccacg
ctggatgccgagcagcagggccaggcgggcatcctggcggatgccgaggtcgaccaggcc
gactatcacgcggtgctgttcgagggcgacggcgacacgctgcgcgccctgaaccagcgc
atcgcgcagcggccgggcgcgatcctggcggtgcacgggctgacctcggacgccttggcg
gccggcgccgcgtatgtgccggaacgcctgctcaccgaacgttccatcagcgtcaatacg
gccgcggccggcggcaatgccagcctcatgaccatcggttga

DBGET integrated database retrieval system