KEGG   Achromobacter denitrificans: APT56_18310Help
Entry
APT56_18310       CDS       T04244                                 

Definition
(GenBank) 5-keto-4-deoxy-D-glucarate aldolase
  KO
K01630  2-dehydro-3-deoxyglucarate aldolase [EC:4.1.2.20]
Organism
adt  Achromobacter denitrificans
Pathway
adt00053  Ascorbate and aldarate metabolism
adt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:adt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    APT56_18310
Enzymes [BR:adt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.20  2-dehydro-3-deoxyglucarate aldolase
     APT56_18310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: ALX84984
Position
complement(4114871..4115638)
Genome map
AA seq 255 aa AA seqDB search
MTSPLPNRFRQRILARERLIGFWMCMSSHITAEVAGLADFDWLLLDGEHSPNTVPMFLQQ
LQALQGSASAAIGRPTWNDPVEIKRLLDIGFYNLLIPFIESEDDARSAVAATRYPPQGIR
GVAGMQRSNRYGTVPDYLKTINDNICVLLQIESRPGIEAVDAIAAVEGVDGVFIGPSDLA
AALGHLGNPGHPEVQEAIRHLYQRVTAQGKAVGILAPVQADARRYLDMGMHFVAVGTDLG
VFKQATFALREAFPT
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgacttcacccttgcccaaccgctttcgccaacgcatcctggcgcgcgagcgcctgatc
ggcttctggatgtgcatgtccagccacatcaccgcggaagtcgcgggcctggccgacttc
gactggctgctgctggacggcgagcattcgcccaacaccgtgccgatgttcctgcagcag
ctgcaggccctgcagggcagcgccagcgccgccatcggccggccgacctggaatgatccg
gtcgagatcaagcgcctgctcgacatcggcttctacaacctgctgatccccttcatcgaa
tccgaggacgacgcgcgcagcgccgtggccgccacgcgctatccgccgcagggcatccgc
ggcgtggccggcatgcagcgcagcaaccgctacggcaccgtgccggattacttgaagacc
atcaacgacaacatctgcgtgctgctgcagatcgagagccggccgggcatcgaggcggtc
gatgcgatcgccgcggtcgagggcgtggatggcgtcttcatcggcccgtcggacctggcc
gcggccctgggccatctgggcaacccgggccacccggaagtgcaggaagcgattcgccac
ctgtaccagcgcgtcaccgcgcagggcaaggcggtgggcatcctggcgccggtgcaggcc
gatgcgcgccgctacctggacatgggcatgcacttcgtcgcggtcggcaccgacctgggc
gtgttcaagcaagccaccttcgccttgcgcgaggccttccccacctga

DBGET integrated database retrieval system