KEGG   Achromobacter denitrificans: APT56_20010Help
Entry
APT56_20010       CDS       T04244                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
adt  Achromobacter denitrificans
Pathway
adt00071  Fatty acid degradation
adt00072  Synthesis and degradation of ketone bodies
adt00280  Valine, leucine and isoleucine degradation
adt00310  Lysine degradation
adt00362  Benzoate degradation
adt00380  Tryptophan metabolism
adt00620  Pyruvate metabolism
adt00630  Glyoxylate and dicarboxylate metabolism
adt00640  Propanoate metabolism
adt00650  Butanoate metabolism
adt00900  Terpenoid backbone biosynthesis
adt01100  Metabolic pathways
adt01110  Biosynthesis of secondary metabolites
adt01120  Microbial metabolism in diverse environments
adt01130  Biosynthesis of antibiotics
adt01200  Carbon metabolism
adt01212  Fatty acid metabolism
adt02020  Two-component system
Brite
KEGG Orthology (KO) [BR:adt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    APT56_20010
   00630 Glyoxylate and dicarboxylate metabolism
    APT56_20010
   00640 Propanoate metabolism
    APT56_20010
   00650 Butanoate metabolism
    APT56_20010
  09103 Lipid metabolism
   00071 Fatty acid degradation
    APT56_20010
   00072 Synthesis and degradation of ketone bodies
    APT56_20010
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    APT56_20010
   00310 Lysine degradation
    APT56_20010
   00380 Tryptophan metabolism
    APT56_20010
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    APT56_20010
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    APT56_20010
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    APT56_20010
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:adt04147]
    APT56_20010
Enzymes [BR:adt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     APT56_20010
Exosome [BR:adt04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   APT56_20010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: ALX85297
Position
4518058..4519350
Genome map
AA seq 430 aa AA seqDB search
MAFKPVYVVDGARTPFLKARSGPGPFAAGDLAVQAGRGLLLRQPYAPTDLDEVIVGCAAP
SADEVNIGRVIALRLGCGNKVPGWTVMRNCASGMQALDSAIANIQTGRSQLVLAGGTDAL
SRAPVLFSDDMVRWLASWYAARGVGAKLATLGRLRLRHLAPVIGLLKGLTDPVVGLSMGQ
TAENVATRFGISRQAMDAYSAQSHARALAGRADGAFAEITPLIDTQGKLYPDDDGVREDS
TPEKLAKLKPVFDKPWGNITAGNSSQVTDGAAMLVLASEEAVRRWNLRPLGRIIDSQWAG
LDPAMMGLGPVHAATPILQRHGLGLNDLDLWEINEAFAAQVLGCLAAWRDEAYCQEHFGT
PAWGELDPARLNVDGGAIAIGHPVGASGARIVLHLLEALKRRGARRGMAAICIGGGLGGA
MLVETLEDRP
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atggcattcaaaccggtatacgtggtcgacggcgcccgcacgcccttcctgaaggcgcgt
tcgggccccggcccgttcgcggccggcgacctggccgtgcaggccgggcgcggcctgttg
ttgcgccaaccctatgcgcccacggacctggacgaggtcatcgtgggctgcgccgcgccg
tcggccgacgaggtcaacatcggccgcgtgatcgcgctgcgcctgggctgcggcaacaag
gtgcccggctggacggtgatgcgcaactgcgcctcgggcatgcaggcgctggattccgcc
atcgccaacatccagaccggccgctcgcagctggtgctggccggcggcacggacgccctg
tcgcgcgcgccggtgctgttctcggacgacatggtgcgctggctggccagctggtacgcg
gcccgcggcgtcggcgccaaactcgccacgctcggccgcctgcgcctgcgccacctggcg
ccggtcatcggcctgctcaaaggcctgaccgacccggtggtgggactgtcgatgggccag
accgccgagaacgtcgccacccgcttcggcatcagccgccaggccatggacgcctattcg
gcgcaaagccacgcgcgggccctggccgggcgcgccgacggcgccttcgccgagatcacg
ccgctgatcgacacacagggcaagctgtatccggacgacgacggcgtgcgcgaggactcc
acgcccgaaaagctggccaagctcaagccggtgttcgacaagccctggggcaacatcacc
gccggcaacagctcgcaggtcaccgacggcgcggcgatgctggtgctggcctccgaggaa
gcggtgcggcgctggaacctgcggccgctgggccgcatcatcgacagccaatgggccggc
ctcgatccggccatgatgggcctggggccggtgcatgccgccaccccgatcctgcaacgc
cacggactcggcctcaatgacctggacttgtgggagatcaacgaagccttcgccgcccag
gtgctgggctgcctggcggcctggcgggacgaggcctattgccaggaacacttcggcacg
cccgcgtggggcgagctcgatccggcgcgcctgaacgtggacggcggcgccatcgccatc
ggccatccagtgggcgcatcgggcgcccgcatcgtgctgcacctgctggaggcgctcaag
cgtcgcggcgcgcgccgcggcatggccgccatctgcatcggcggcggcctgggtggcgcc
atgctggtcgaaaccctggaggaccgcccatga

DBGET integrated database retrieval system