KEGG   Achromobacter denitrificans: APT56_26275Help
Entry
APT56_26275       CDS       T04244                                 

Definition
(GenBank) hydrolase
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
adt  Achromobacter denitrificans
Brite
KEGG Orthology (KO) [BR:adt00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    APT56_26275
Enzymes [BR:adt01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     APT56_26275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-ProteinID: ALX87119
Position
5879109..5879918
Genome map
AA seq 269 aa AA seqDB search
MRVAAIQLDSRRDRHANLAALEHWITAAANDGAKLIVTPEYSDVRGDTPTLRAAASPIPG
AVTARIAALAQRHACWIHLGSMHERLADQDRLGNTGVTFAPDGSIAASYRKVHLYDAVVD
GIPYRESADFAPGAHLRTVEAAGLTLGLSICYDLRFAELYRALRARGANVLVVPAAFNLH
TGRDHWETLLRARAIENQCYVIAAAQIGGDGPGLPCLGRSMIIDPWGTVLACMPDRTGYV
MADLDPQRVATLRAGLPAWEHRRNDLYPG
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atcagagtggcagccatccagctcgatagccgccgtgaccgccatgccaacctggcggcg
ctggaacattggataacggccgcggccaacgacggcgcgaaactgatcgtcacgcccgag
tacagcgatgtgcgcggcgacacgccaacgctgcgcgccgccgccagtccgatccccggc
gcggtcacggcgcgcatcgccgcgctggcgcaacgccacgcttgctggatccacctgggc
tcgatgcatgaacgcctggcggaccaggaccgactcggcaacaccggcgtcaccttcgcc
ccggacggcagcatcgccgcctcctaccgcaaggtccacctgtacgacgcggtggtcgac
ggcattccctaccgcgaatccgccgacttcgcgcccggcgcgcacctgcggaccgtcgag
gcggcgggcctgacgctgggcctgagcatctgctacgacctgcgtttcgccgagctgtat
cgcgcgctgcgcgcacgcggcgccaacgtgctggtggtgcccgcggccttcaacctgcac
accgggcgcgatcattgggaaaccctgctgcgcgcccgcgccatcgagaaccagtgctac
gtgatcgccgccgcccagatcggcggcgacggcccgggcctgccctgcctcggccgcagc
atgatcatcgacccctggggcacggtgctggcctgcatgcctgaccgcaccggctacgtc
atggccgacctcgacccgcagcgcgtggccacgctgcgcgccggcctgccggcctgggag
catcgccgcaacgatctctacccgggttga

DBGET integrated database retrieval system