KEGG   Arachis duranensis: 107459962Help
Entry
107459962         CDS       T04300                                 

Definition
(RefSeq) heat shock 70 kDa protein 5
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
adu  Arachis duranensis
Pathway
adu03040  Spliceosome
adu04141  Protein processing in endoplasmic reticulum
adu04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:adu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    107459962
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107459962
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107459962
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:adu01009]
    107459962
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:adu03041]
    107459962
   03009 Ribosome biogenesis [BR:adu03009]
    107459962
   03110 Chaperones and folding catalysts [BR:adu03110]
    107459962
   04131 Membrane trafficking [BR:adu04131]
    107459962
   03051 Proteasome [BR:adu03051]
    107459962
   03029 Mitochondrial biogenesis [BR:adu03029]
    107459962
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:adu04147]
    107459962
Protein phosphatases and associated proteins [BR:adu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     107459962
Spliceosome [BR:adu03041]
 Complex B
  Other components
   Prp19 complex
    107459962
 Complex C
   Prp19-CDC5 complex
    107459962
Ribosome biogenesis [BR:adu03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    107459962
Chaperones and folding catalysts [BR:adu03110]
 Heat shock proteins
  HSP70 / DNAK
   107459962
Membrane trafficking [BR:adu04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    107459962
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    107459962
Proteasome [BR:adu03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    107459962
Mitochondrial biogenesis [BR:adu03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    107459962
Exosome [BR:adu04147]
 Exosomal proteins
  Proteins found in most exosomes
   107459962
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C Hydantoinase_A Zincin_2
Motif
Other DBs
NCBI-GeneID: 107459962
NCBI-ProteinID: XP_015933769
Position
A07
AA seq 644 aa AA seqDB search
MATATEKAIGIDLGTTYSCVAVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ
VAMNPQNTVFDAKRLIGRRFSDPSVQSDMRHWPFKVVSGPQDKPMIVVNYKGEQKQFAPE
EISSMVLTKMKEIAEAYLGKTIKNAVVTVPAYFNDSQRQATKDAGAIAGLNVMRIINEPT
AAAIAYGLDKKASKTGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDN
RLVNHFAAEFKRKHKKDMSSNARALRRLRTACERAKRTLSSTAQTTIEIDSLFEGIDFYA
TITRARFEELNMDLFRKCMEPVEKCLRDAKVDKAQIHDIVLVGGSTRIPKVQQLLQDFFN
GKELCKSINPDEAVAYGAAVQAAILSGEGDQKVQDLLLLDVTPLSLGIETAGGVMTVLIP
RNTTIPTKKEQVFSTYSDNQTSVLIQVYEGERARTKDNNLLGTFELKGIPPAPRGVPQIN
VCFDIDANGILNVSAEDKTAGVKNKITISNDKGRLSKEEIERMVQEAEKYKAEDEQVKKK
VDAKNSLENYAYSMRNTIKDDNVGAKLDPSDKQRIEKAIDDTIQWLDGNQLAEVDEFEDK
LKELEALCNPVISKMYQGGGTAAPSSADAAHDNSAGGPKIEEVD
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
atggctaccgctactgagaaagccattggcatcgatctaggcaccacttacagctgcgtg
gccgtgtggcaaaacgaccgcgtagagatcatcgccaacgaccaaggcaaccgaaccact
ccttcctacgttgccttcacggacaccgagcgcctcatcggagatgctgccaagaaccag
gtggcaatgaacccacagaacacggtgttcgacgccaagcgcctcatcggtcgtagattc
tccgacccttccgtccagagcgacatgaggcactggcccttcaaggtggtctccggcccc
caagacaagcccatgatcgtcgtcaactacaaaggcgagcagaagcagttcgcacccgag
gagatttcctccatggtgctcaccaagatgaaggagatcgccgaggcctacctgggaaaa
accatcaagaatgccgtcgttaccgtccccgcctacttcaacgactctcagaggcaggcc
accaaggacgccggcgccattgcaggcctcaacgtcatgagaattatcaacgagccaacc
gccgctgctattgcctacggcttagacaagaaggcctccaaaactggcgagaagaacgtc
ctcatcttcgacctcgggggtggcacctttgacgtgtctctcctgactatcgaggagggc
atctttgaggtgaaggccactgccggagacacccacttggggggcgaggatttcgacaac
aggctggtgaatcacttcgcggcggagttcaagaggaagcacaagaaggacatgagcagc
aacgcgagagcgctacggagactgaggacagcgtgtgagagggccaagaggacactctcc
tccaccgcacagacgaccatcgagatcgactcgctctttgaaggtattgatttctacgcg
accatcactcgggccaggttcgaggaactcaacatggacctgttcaggaagtgcatggag
ccggttgagaagtgtctccgcgatgccaaggttgataaggctcagattcacgacattgtc
cttgttggcggctccaccagaatccccaaggtccagcagcttctgcaggacttcttcaat
ggcaaggagctctgcaagagcatcaaccccgacgaggccgtggcttacggggctgctgtc
caagctgccatcctgagcggcgaaggcgaccagaaagtccaagacttgcttcttctcgac
gtcacgcccctcagcctgggcattgaaaccgccggtggggtgatgacggtcttgattccc
aggaataccaccatacccaccaagaaagagcaggtgttttccacctactcggacaaccag
accagcgtgctgattcaggtgtacgagggtgagagggcaagaaccaaggacaacaacctt
ttgggaacatttgagctcaaggggattccgccggcgccgagaggggtgcctcagatcaac
gtgtgcttcgacatcgatgccaacggtatcttgaacgtgtctgcggaggacaagacggcg
ggggtgaagaacaagatcaccatcagcaatgacaaaggaaggctgagcaaagaggagatt
gaaagaatggtgcaggaggcagagaagtacaaagcagaggatgaacaggtcaagaagaaa
gtggacgccaagaactcactggagaattatgcttacagcatgaggaacaccatcaaggat
gacaatgttggtgccaaacttgatccttctgacaagcagaggatcgagaaggccattgat
gacaccatccaatggttggacgggaaccagttggcggaagtagatgagtttgaggacaag
ctcaaggagcttgaggctttatgcaaccctgtcatttccaagatgtatcaaggtggtggt
actgctgctccatcctctgccgatgctgcccatgacaactccgctggtggacctaagatt
gaagaggttgattga

DBGET integrated database retrieval system