KEGG   Arachis duranensis: 107460132Help
Entry
107460132         CDS       T04300                                 

Definition
(RefSeq) ribulose bisphosphate carboxylase small chain, chloroplastic
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
adu  Arachis duranensis
Pathway
adu00630  Glyoxylate and dicarboxylate metabolism
adu00710  Carbon fixation in photosynthetic organisms
adu01100  Metabolic pathways
adu01110  Biosynthesis of secondary metabolites
adu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:adu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    107460132
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    107460132
Enzymes [BR:adu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     107460132
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-GeneID: 107460132
NCBI-ProteinID: XP_015933950
Position
A01
AA seq 218 aa AA seqDB search
MQLSTFKCPQFTKYYHLSGSPFIPLYYSFLHNFISASFKIRSTFSLRNMYAGSFAAPVSG
AGYVGLKANSSNLYTTTNIEWCKTKNIVSNGSKTHCMKTWNPINNRKFETLSYLPPLSDE
SIGKEIDYMLKKGWTPCLEFDEVGCIRRENSRMPGYYDGRYWTLWKLPFFGCTDSSQVMN
EIKECKEQYPNAYIRCLAFDDHRHMQAMAFLIHKPPST
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgcaactctccactttcaagtgcccacagtttactaaatactatcatctttcaggatct
cccttcattccattatattattcttttcttcacaacttcatcagtgcctccttcaagatc
agatcaaccttcagtttgagaaacatgtatgctggaagttttgcagctccagtttctggg
gctggctatgttggtttaaaggccaactcttcaaatctttatactactactaacattgaa
tggtgcaagacaaagaacatagtctccaatggttccaaaactcactgcatgaagacatgg
aatccaatcaataataggaagtttgagacactgtcatacctgcctccactttcagatgag
tccattggaaaggagattgactacatgctgaaaaaaggatggactccttgccttgaattt
gatgaggtagggtgtattagaagagagaacagcagaatgccagggtactatgatggaaga
tattggacactgtggaagctaccattttttggttgcactgattcatcacaagtaatgaat
gagatcaaagagtgcaaagagcaatacccaaatgcttatataagatgtttggcttttgat
gatcatcgtcacatgcaagccatggcttttctcatccacaaacctccttccacttaa

DBGET integrated database retrieval system