KEGG   Arachis duranensis: 107461898Help
Entry
107461898         CDS       T04300                                 

Definition
(RefSeq) xylogalacturonan beta-1,3-xylosyltransferase
  KO
K18789  xylogalacturonan beta-1,3-xylosyltransferase [EC:2.4.2.41]
Organism
adu  Arachis duranensis
Brite
KEGG Orthology (KO) [BR:adu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:adu01003]
    107461898
Enzymes [BR:adu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.41  xylogalacturonan beta-1,3-xylosyltransferase
     107461898
Glycosyltransferases [BR:adu01003]
 Polysaccharide
  Structural polysaccharide
   107461898
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Exostosin Orbi_VP4 TMEM52 Glycos_transf_1
Motif
Other DBs
NCBI-GeneID: 107461898
NCBI-ProteinID: XP_015935948
Position
A01
AA seq 462 aa AA seqDB search
MKLKGLKSQICLLLLLLVLLLNFSLVFFTPSNEEQHRMIHRIHSDSPFPPSSSTRGNQHP
KEILSTAANNDSLVHTRITSLERIEGGLARARASILEAIRSSNHTKPKGSIYLNPRAFHQ
SQNEMKKRFKVWVYKEGEQPLVHDGPVNNKYAIEGQFIDEIENKKSHFIANNPEHAHVFL
IPLSISKVIRYVYKPRRSRYDYDPERLQRLVEDYISVVATKYPFWNRSTGADHFLISCHD
WGPRISYANPQLFKNFMRVLCNANTSEGFLPNRDVSIPEVYLPVGKLGPPNTAQHPAKRT
ILAFFAGGAHGFIRKRLLKRWKNKDKEVQVHEYLEKGQDYTKLMGLSKFCLCPSGYEVAS
PRVVEAIYAGCVPVIICDNYSLPFSDVLNWNKFSMQIEVGRIPEIKTILQNVTQDKYMEL
YFSVRRVRKHFVINRPARPFDLIHMILHSIWLRRLNFRLVTS
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgaaattgaaaggattgaaatcccaaatatgtttgttgttgttgttgttagtgttactc
ctcaatttctcccttgttttcttcactccctcaaatgaagaacaacaccgtatgattcat
agaattcactcagattctcccttcccaccttcttctagcaccagaggcaaccaacatcca
aaagaaattctctccaccgctgcaaataatgattcactagttcatacaaggatcactagt
ttggagagaattgaaggtggtttggcacgggcacgagcctccattcttgaagctattagg
tccagcaaccacacaaaaccaaaaggatccatttacttgaatcctcgcgcttttcaccag
agtcagaatgagatgaagaagaggttcaaagtgtgggtgtacaaggaaggagaacaacca
ttggtgcatgatggacctgttaacaacaaatacgcgattgagggacaattcattgatgaa
atagagaacaagaagagccacttcattgctaacaatccagaacatgcccatgtattctta
attccgttgagcatatcaaaggtgattcggtatgtttacaagccaagaaggtcgagatat
gactatgaccctgagcgcctacagcgtctggtggaggattacatttctgttgttgcaacc
aagtaccctttttggaacagaagcacaggtgctgaccactttctcatttcatgccatgat
tggggtcccagaatttcatatgcgaatccccaactcttcaagaactttatgagggtacta
tgcaatgccaacacctcagaaggctttctgcccaacagagacgtgtccatccccgaagtg
tacctgccagttggaaagctaggcccaccaaacacggcccaacaccccgctaaaaggaca
atactagccttcttcgcaggtggggcgcacggtttcattagaaaaaggctgctcaagcgt
tggaagaacaaggacaaagaagtccaagtccatgagtaccttgaaaagggccaagactac
acaaagttgatgggcctaagcaagttttgcttgtgccctagtggatatgaagttgcaagt
cctagggttgtggaagcaatttatgcagggtgtgttccagttataatttgtgataattac
tctctgcccttcagtgatgtccttaattggaataaattctccatgcaaattgaagttggg
agaataccggaaattaagactattttgcaaaatgtaacacaggataagtatatggagttg
tattttagtgtgaggagggttagaaagcattttgtgataaataggcctgcaaggccattt
gatttgattcatatgatacttcactccatatggttaagaaggctaaattttcggctagta
acttcataa

DBGET integrated database retrieval system