KEGG   Arachis duranensis: 107462299Help
Entry
107462299         CDS       T04300                                 

Definition
(RefSeq) probable terpene synthase 2
Organism
adu  Arachis duranensis
SSDB OrthologParalogGFIT
Motif
Pfam: Terpene_synth_C Terpene_synth ANTAR
Motif
Other DBs
NCBI-GeneID: 107462299
NCBI-ProteinID: XP_015936363
Position
A08
AA seq 563 aa AA seqDB search
MTVTANSDQHASSYIARPCANFRPNIWGDIFLQYHNSPLDVVNENMRQQLETCKEEVKKI
FLSSSNNISQKLNIIDSMQRLGISYHFEREIDQALEQIQKISINNALDIEEGDLHSIGLL
FRLLRQKGYHISSDIFNKFKNKEGKFNETIVEDVEGLWSLYEATQLSTHGEDSIDEAHDF
AYTNLKSMITKNKLSTYLAKQIDQSLTLPIHKGVPRIETRRYMSFYEEDPSHDRVLLRFA
KLDFNVLQKMHQKELGNITRWWKESDFATKVPYARERVVEAYLWPFSMSSEPKCSTHRRI
VGKLISCICLLDDTYDAYGTLQELELFTQAIKRWNANPIKSLPTCFKVVFTAILEVVDEI
ESAVVDAKKSTLVSKHVKQAFLNLAEAYLLEAKWCNEDYVPTYDEYKVNGAMSSSLQLHI
VAFVGLGEFATKEVFDWIFSDPTTIIKAVSLVGRLKDDLASHKFERERDHHVASAVECCM
KQYGISQEETYKLIQKEIKDFWKDINEVCLNPNNHIPKAVLECVVNLGRISEFTYANFQD
RFTNGEFMKECVSELLLDPIAIY
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atgactgttacagctaattctgatcaacatgcatcatcttacattgcacgaccatgtgca
aattttcgtcccaacatttggggggatattttccttcaatatcataattcaccattggat
gtcgtgaatgaaaatatgaggcaacaacttgaaacatgtaaagaggaagtgaagaagatt
tttctatcttctagcaataatatctcacaaaaattaaacatcattgactcaatgcaacgt
ttgggtatatcttatcattttgaacgtgaaattgaccaagcattagaacaaatccaaaag
atttccatcaataatgcactcgacatagaagaaggtgacctacactctattggattactc
tttagattgcttagacaaaaaggatatcacatttcatcagacatattcaacaaattcaag
aataaggagggaaagttcaatgaaaccattgtggaagatgttgaaggattatggagtttg
tatgaggcaacacaattaagcactcatggtgaagattcaatagatgaagcacatgatttt
gcttacactaacctcaagtccatgatcaccaaaaataagttgagcacatatcttgctaag
caaattgatcaaagcttaacgctaccaattcacaagggagttccaaggatagagacaaga
cgttacatgtccttctatgaagaggatccttctcatgacagagtccttctacgttttgca
aaattagattttaatgttttacagaaaatgcatcaaaaagaacttggaaatatcacaagg
tggtggaaagaatcagattttgcaactaaggttccctatgctagagaaagggtggttgag
gcatacctttggccattttctatgtcttcagagcctaaatgtagcactcacagaaggatt
gttggcaaattgatttcatgtatttgtcttcttgatgatacttatgatgcctatggcact
cttcaagaacttgaactcttcacacaggcaatcaaaagatggaatgctaatcctatcaaa
tctcttccaacatgtttcaaagtggtatttaccgcaattttagaagtggtggatgaaatt
gaatcagcagtagtagatgcgaaaaaatcaaccctagtgtcgaaacatgttaaacaagcg
tttctgaatttggctgaagcttacttgttggaagcaaaatggtgcaatgaggattatgtt
ccaacttatgatgaatacaaggttaatggagctatgtcttcttcattgcaacttcacata
gtagcatttgttggtcttggtgaatttgcaaccaaagaagtctttgattggatatttagt
gatccaacaacaattataaaagctgtatcacttgttggcagactcaaggatgatctggct
tcacataagtttgagcgggaaagagatcatcatgttgcttcagcagttgaatgttgcatg
aagcaatatggaatttcacaagaagagacatacaaactcattcaaaaggaaatcaaagat
ttttggaaggatataaatgaagtgtgcctcaatccaaataatcatattccaaaggcagtg
cttgagtgtgttgttaatttgggacgtatatctgagttcacatatgcaaactttcaagat
agattcacaaacggagaatttatgaaagaatgcgtttctgaactacttttagatcccatc
gctatttactag

DBGET integrated database retrieval system