KEGG   Arachis duranensis: 107462479Help
Entry
107462479         CDS       T04300                                 

Definition
(RefSeq) UDP-glycosyltransferase 79B30
  KO
K22794  flavonol-3-O-glucoside/galactoside glucosyltransferase [EC:2.4.1.239 2.4.1.-]
Organism
adu  Arachis duranensis
Pathway
adu00944  Flavone and flavonol biosynthesis
Brite
KEGG Orthology (KO) [BR:adu00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00944 Flavone and flavonol biosynthesis
    107462479
Enzymes [BR:adu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.239  flavonol-3-O-glucoside glucosyltransferase
     107462479
    2.4.1.-  
     107462479
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_transf_28 Glyco_transf_4 Glyco_tran_28_C
Motif
Other DBs
NCBI-GeneID: 107462479
NCBI-ProteinID: XP_015936564
Position
A08
AA seq 456 aa AA seqDB search
MDASSPLHIAMFPWFAMGHLIPYLHLSNKLAKRGHRISFFTPKRTQSKLQHLNLHPQLIT
FIPITVPHVDTLPLHAETTSDVPFSSYKHIATAMDHTEKDIELLLQNLKPQIVLFDFQHW
LPNLARSLGIKSVQYIIGNPATFAYLSAHTIGIHFTTENLMKPPQGFPDSSIRLRAHEAQ
RVVTASKFEFGSGITLYDRFNTGTKFADAVAYKGCREIDGDYINYMKSQLERKPIMLSGP
LLPEPTNSTLDEKWDSWLSGFNTKHVIYCALGSECSLNKSQLQELVLGLELTGFPFLAAL
KPPVEFDSIEQVLPEGFKERVEGNGVVYDGWVQQQLILEHPSVGCFITHCGAASITEALV
SSCQLVLLPGPYSDHAIAARNLGSRLKVGIEVEKGEEDGLFTKENVCVAVKTVMDDENQV
GKEIRENHSKIRNLLLSNDFESSCIDGFVCELQSLL
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atggatgcttcttctcctctgcacatagcaatgtttccatggttcgcaatgggacaccta
atcccatatcttcacctctccaacaagcttgcaaaaagaggccatagaatctccttcttc
actccaaaaagaacacaatcaaagcttcaacacctaaatcttcacccacaactcatcacc
ttcatccccatcactgttcctcacgtggacacccttcccctccatgcagagaccacttca
gacgttcccttctcttcctacaaacacatcgccaccgccatggaccatactgagaaagac
atagagcttctcctccagaatctaaagccgcaaattgttctcttcgatttccaacattgg
cttccaaacttggcgcgaagcctcggcattaagagtgtccaatacataatcggtaaccca
gccacttttgcatacctttcagcccacacaataggaattcattttactacagaaaacctt
atgaaaccgcctcaggggtttccagattcatctatcaggcttcgtgcacatgaagctcaa
cgcgttgtaaccgccagcaagtttgaatttggtagcggtatcactctctatgatcgtttc
aacactggtacaaaattcgcggacgcagtggcctacaaaggttgcagagaaatcgacggt
gattatataaactacatgaaatcccagctcgagaggaaaccaattatgctttcgggtcct
cttttaccagaaccaaccaactcaaccttggacgaaaaatgggattcatggctctcaggc
ttcaatactaaacatgtaatttactgcgcattgggaagtgaatgttctttaaacaagtct
caattacaagaattagtgctcggtcttgaactaaccggttttccgtttcttgcggcgctt
aagccaccggttgagtttgattcgattgaacaggtgttaccggaagggtttaaagaaaga
gttgaaggaaacggagttgtgtatgatggatgggttcagcaacaattgattttggagcac
ccttctgttgggtgcttcataacacattgtggagcagcttccataaccgaagcgctcgtg
agttcgtgtcagctcgtgttgctgcctgggccttatagtgatcatgcaattgctgcgagg
aatttggggagtaggttgaaggttgggattgaagttgaaaaaggtgaggaggatgggttg
tttaccaaagagaatgtgtgcgtagctgttaagactgtgatggatgatgagaatcaagtt
ggaaaagaaataagagaaaatcatagcaaaattaggaatcttttgctaagcaatgatttt
gagtcttcttgtattgatggttttgtttgtgagcttcagtctttgctttga

DBGET integrated database retrieval system