KEGG   Arachis duranensis: 107463290Help
Entry
107463290         CDS       T04300                                 

Definition
(RefSeq) probable terpene synthase 2
  KO
K15803  (-)-germacrene D synthase [EC:4.2.3.75]
Organism
adu  Arachis duranensis
Pathway
adu00909  Sesquiterpenoid and triterpenoid biosynthesis
Brite
KEGG Orthology (KO) [BR:adu00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00909 Sesquiterpenoid and triterpenoid biosynthesis
    107463290
Enzymes [BR:adu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.75  (-)-germacrene D synthase
     107463290
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Terpene_synth_C Terpene_synth HU-CCDC81_bac_2 Cob_adeno_trans GCR1_C
Motif
Other DBs
NCBI-GeneID: 107463290
NCBI-ProteinID: XP_015937553
Position
A08
AA seq 571 aa AA seqDB search
MCSTNTSILDCFNPDAKFNMIDRNTANYHPSIWKDYFLQYASQSMEFDDETKAQIQKLKK
QVVKMLIDASKPIEEIVDLIDLICHLGIRYHFESEIDEVLQQIHNNYTKNEEIIIVDDNL
RLLALLFRLLRQQGYHVSPNVFNKYKDENGNFSEQLVKDVEGLLELYEASHLRIHGEEIL
DEAYVFTSTQLKSIATQLKPSLAAQVNYSLRQSLHRGLPRLEARRFISIYEEDPTHNHTL
LTLAKLDFNFLQNLHRKEVGNITKWWRELDVAANFPYARDRIVECCNWSMAVYFEPQYSQ
ARKILTKLIALVSIIDDTYDAYGTIDELKLFTEAIERWDLGCLNVLPEYMKLIYKSLFQI
YEETQQEVEKQGTTYCIKYSIKALQETTQAYMTEAKWLNNKYIPTIAEHLQISTLSCGYP
FLMTSSYIGMGDTAVEDIFKWVTSKPKIATASTIVCRFMDDIVSSEFEQEREHIVPLLEC
YMREYDISKEEAIQELQKGVTDAWKNINEECLKPTEVPVMFLMRIVNMARFIDVMYKDED
CYTHAKGKMKECIEALLVDPLPIKSEENFLI
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
atgtgtagtactaacacttcaatacttgattgcttcaacccggatgcaaaattcaacatg
attgatcgaaacactgcaaattatcatcctagtatttggaaggattatttccttcaatat
gcttcacaatccatggaatttgatgatgaaacgaaggcacaaattcaaaaactgaagaaa
caagttgtcaaaatgcttattgatgcctcaaaacccattgaagaaatagttgacttgatt
gatttaatatgtcatttgggcattcgatatcactttgaaagcgagattgatgaagtgctg
caacaaattcacaacaattataccaaaaatgaagaaataataattgttgatgataacctt
cgcttacttgctttgctttttaggttattaaggcaacaaggatatcacgtttcaccaaat
gtgttcaacaaatacaaggatgagaatggaaactttagtgaacaacttgtgaaggatgtg
gagggattgctagaattgtatgaagcatctcatcttagaattcatggagaagaaatatta
gatgaagcttatgtattcacttccactcaacttaaatccattgccacccaattgaagcct
tctcttgcagcacaagtcaactatagtttaaggcaatctttacaccgaggtttgccaaga
ttggaggcacggcgttttatttcaatatatgaagaagatccaacccataatcacacacta
ctcactcttgcaaaattagattttaatttcctacaaaacttgcatcgaaaagaagttggc
aacattaccaagtggtggagggagcttgatgttgctgcaaattttccatatgctcgagat
agaattgtggaatgttgtaactggagtatggcggtttattttgagccccaatattctcaa
gctagaaaaatactgacaaaactgatcgctcttgtgtcaattattgatgatacatacgat
gcgtatggaactatagatgaactaaaacttttcactgaagcaattgaaaggtgggatctt
ggctgtttgaatgttcttccagagtacatgaaattaatttataagtctctctttcagatt
tatgaagaaacacaacaagaagtcgaaaagcaaggaacaacatattgcattaaatattcc
ataaaagcacttcaggagacaacccaagcctatatgaccgaggccaaatggttgaataac
aagtatataccaacaatagcagagcacttacagatatcaacattatcatgtggttatcca
ttcctcatgacaagttcttacattggcatgggagataccgcggtagaagacatcttcaaa
tgggtaacaagtaaacccaaaattgctacagcttccacaattgtttgcaggttcatggat
gacatagtctctagtgagtttgaacaagaaagagaacatattgtcccactcttagaatgc
tatatgagagaatatgatatatccaaagaagaagccattcaagaattgcaaaagggagtt
acagatgcttggaagaatataaatgaagaatgcctgaagccaacagaagttccagtgatg
tttctaatgcgaattgtcaacatggcacgatttattgatgtgatgtacaaagatgaagat
tgttacactcatgctaaaggaaaaatgaaggaatgcatcgaagctttgcttgttgatccg
ttgccaataaaatcggaggagaattttcttatttaa

DBGET integrated database retrieval system