KEGG   Arachis duranensis: 107465617Help
Entry
107465617         CDS       T04300                                 

Definition
(RefSeq) glutathione S-transferase 1
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
adu  Arachis duranensis
Pathway
adu00350  Tyrosine metabolism
adu01100  Metabolic pathways
Module
adu_M00044  Tyrosine degradation, tyrosine => homogentisate
Brite
KEGG Orthology (KO) [BR:adu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    107465617
Enzymes [BR:adu01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     107465617
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2
Motif
Other DBs
NCBI-GeneID: 107465617
NCBI-ProteinID: XP_020987560
Position
A09
AA seq 149 aa AA seqDB search
IALFKQPSEFLKLNPLALIPILVDGDFILAESLAIIMYLDDKYPQYPLLPHDVPKRALNF
QVAHIVLQDNFIEKKVGPHEKLPWAQSVIRKGFTALEKLLKDHAGRYATGDEIFLCKITW
RILIGVAVENVIRQPIPKVSSTVFLKIWR
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
attgccttgtttaaacaaccatcagagttcctcaagttgaatcctcttgctttaattcct
attctggtggatggcgattttattcttgctgaatccttagccattattatgtatttggac
gataagtatcctcaataccctttgctgcctcatgacgttcccaaaagagcactcaatttt
caggttgcacatattgttttgcaggataacttcattgagaaaaaggttggccctcatgaa
aaacttccttgggcacaaagtgtcattagaaagggcttcacagcacttgaaaagctattg
aaagatcatgcagggagatatgccactggagatgaaatttttctgtgcaagatcacttgg
aggattttaattggtgttgccgtggaaaatgtaatccgacagcccattccaaaggtaagc
agcactgtatttctcaaaatttggaggtga

DBGET integrated database retrieval system