KEGG   Arachis duranensis: 107469111Help
Entry
107469111         CDS       T04300                                 

Definition
(RefSeq) ATP-dependent RNA helicase DEAH11, chloroplastic
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
adu  Arachis duranensis
Pathway
adu03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:adu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    107469111
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:adu03041]
    107469111
Enzymes [BR:adu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     107469111
Spliceosome [BR:adu03041]
 Complex C
  Other components
   Step II factors
    107469111
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Helicase_C IBR OB_NTP_bind HA2 DEAD AAA_22 AAA_19 AAA_30 Helicase_RecD ABC_tran AAA_29 ResIII TMF_TATA_bd AAA_23 DUF2075 RsgA_GTPase
Motif
Other DBs
NCBI-GeneID: 107469111
NCBI-ProteinID: XP_015943979
Position
A10
AA seq 1748 aa AA seqDB search
MHHPDYNHRQPPPFRRHFSKPIDFHPNHYRPPGPPNPIAFQAPNFVLHLRRGRRHLRRDL
INSIISQCPSKPQSFSILPYSSDHNYHRRSSSTVDAAILNFLQWVDTLNAVAYLWETRLD
GMHDLTPELKSNVMVPSDEDELYSRLRAVFARHVKSLMQEAKELKRWEGESERLTKEIAG
MEPQKKNKHYQVGEFFQMNENKKRFEEEKNLVERRVREFRCAMECLLKLLEEKGGVDEER
NEGVTGNYYYHDYDYDAVFRFDGRLNWKRVHSIIMRERRRLEEGLPIYAYRRDILHDIHH
QQITVLVGETGSGKSTQLVQFLADSGVGAAESIICTQPRKIAARSLAQRVQEESNGCYEG
NAINSYSTFSSLNEFDSKITFMTDHCLLQHYMADKNLSGVSCIIVDEAHERSLNTDLLLA
LIKNLLCRRVEMRLIIMSATADAKQLSEYFYSCRIVHVLGRSFPVDVKYVPSDYAGHSES
GIAPYVSDVVRMAIEIHKTEEEGTILAFLTSQIEVEWACDNFEALSAVALPLHGKLLPGE
QFHVFQNYPGKRKVIFATNLAETSLTIPGVKYVIDSGLIKDSRYDPGSGMNVLKVCWISQ
SSANQRAGRAGRTEPGRCYRLYSEADYQCMEQNQEPEIRRVHLGVAVLRILALGVKNVQE
FDFVDAPSQSSIEMAIRNLILLGVIQMKNNVIELTNEGRYLVRMGIEPRLGKLILGCLHH
TLGREGIVLAALMANASSIFCRVGSEKDKQRSDCLKMQFCHCDGDLFTLLSVYKEWEGLP
RERRNQWCWENSINAKSMRRCQDTIIELESCLERELNLVVPSYWRWTPQMPSECDMYLKR
VILSSLPENVAMYSGCKQLGYEVAQTGQHVQLHPSCSLLVFAQKPSWVVFSELLSHSNQY
LVCVSAFDFESLHSLDPPPLFDVCNMEKRKLETRTLSGFCCTLLKKFCGKGNGNLISLVS
RIRKVCEDERISIEVNVDHNDIQLYATSHDMETAVQYVNEVLECEKKWLRTECIEKCLYH
GSGFSPIALFGSGAEIKHLELGKRSLSVDVCHPNTDAIEDKQLLMFLEKNTSASVCSVHK
YTCTGRDVDDREKWGRITFLSPDAALRAAELDGEEFCGSPLKISHSQTASGDKSFLFPAV
KAKIFWPRRLSKGVAIVKCDIKDVDIMLRDFYSLSIGGRYVRCEPGRKDVDSVVISGFDK
ELSDAEILDVVRNATSIRISDFFLIRGDAVGNPPVSACEEALLKEISPFMPKKDPHINSC
RVQVFQPEPRDVSMRALITFDGRLHLEAAKALEQIEGKVLPGCLSWQKIKCQRVFHSSLI
VPLPVYRVIREELEKILKSFSNLKGVECRLEKTSNGSQRLKITANATQTVAEVRRPFEEL
SRGKRIDHASLTPAVVQLLLSREGFNLKSSLQQETGTYILIDRYNLSVRVFGPPDKVCLA
QQKLIQSLLSFHEAKQLEIHLRGRDLPPDLMKQVVKQFGPDLSGLKVKVPGADLVLNIRR
QIIYLRGNKELKQKVEEFIFEIVRSSHRAVEGLGTGPSCPICLCEVEDGYLLEGCCHLFC
RSCLVDQCESAIRNQGTFPICCAREGCGDPILVTDLKALLLGDKLEELFRASLGSFVASS
GGTYRFCPSPDCPSVYRVADPGTAGEPFVCGACYSETCTRCHLEYHPYISCDQYREFKDD
PDSSLKAWCSGKEHVKRCPSCGYTIEKVDGCNHIECKCGKHVCWVCLEFFGSSDNCYDHL
RNIHMAII
NT seq 5247 nt NT seq  +upstreamnt  +downstreamnt
atgcatcaccctgactacaaccatcgtcagccaccgccatttcgccgccacttctcgaag
ccaatcgattttcaccctaaccactaccgtccgccgggacctccaaatcccatcgccttc
caggctcccaattttgttctccacctccgccgcggccgccgccatctccgccgcgacctc
ataaactcgatcatctcccagtgcccttccaaaccacaatctttctcaattttgccctat
tcctccgaccataactaccaccgccgttcctcgtccaccgtcgatgcggcgatcctcaat
ttccttcagtgggtggacacgctcaacgccgttgcgtatctctgggaaacgcgactcgac
ggcatgcacgacctaactccggagctgaagtccaatgtgatggtcccttccgacgaggac
gaactctattctcggctacgtgctgtcttcgcgcgtcacgtgaagagtctcatgcaagaa
gcgaaggaattgaagcgttgggaaggggagagtgagcgattaacgaaggagatcgcgggt
atggagccacagaagaagaacaaacattatcaagttggggaattttttcagatgaatgag
aataagaaaaggtttgaggaagagaaaaatctggtggaacggagggtgagggaatttcgg
tgcgccatggagtgcctactgaagcttctagaagagaagggtggtgttgatgaggaaagg
aatgaaggggttactggtaattattattatcatgattatgattatgatgctgtgtttagg
tttgatggaaggttgaattggaagagggttcacagtattattatgagggagcgtcgtaga
cttgaggagggtttgccaatttacgcttaccggagggatattcttcacgacattcatcat
cagcagataacggtattggttggagagactggttctggaaagagtactcagctggtacag
tttcttgcggattcaggtgtaggagctgctgagtcgattatatgcacccaaccccgaaaa
atcgctgccagatcattagctcaaagagtacaggaagaaagcaatggatgttatgaaggc
aatgcgatcaatagttattcgacattttcatccttgaatgagtttgattctaaaataaca
ttcatgacagaccactgtttattgcagcattacatggctgataagaatttgtctggtgtc
tcatgcatcatagttgatgaggctcatgaaaggagcttaaacactgatctgttgttggca
ttgatcaagaatttactctgtagaagggttgaaatgcggcttatcattatgtctgccaca
gctgatgcaaagcagctgtctgaatacttctatagttgtcgaattgttcatgtgctcgga
agaagctttcccgtggatgtgaaatatgttccttctgactatgcaggacattctgagtct
ggcattgccccttatgtttctgatgttgtcagaatggcaatcgagattcacaaaacagag
gaagagggcactattcttgcatttttgacctcacagatagaagtggaatgggcgtgtgac
aactttgaagctctgtctgcagttgctttgcccttacatgggaaacttttgcccggtgag
caatttcatgttttccagaactatcctggaaaaaggaaagtgatatttgcaaccaatctt
gctgagacatctctcacaattcctggggttaagtatgtgatagattctggtttgattaaa
gatagtcgatatgatcctggtagtgggatgaatgttcttaaggtttgttggattagccaa
agctctgctaatcaacgggccggccgtgctgggaggactgaacctggtcggtgctataga
ttgtactctgaagctgattatcagtgcatggaacaaaatcaagaacctgaaattagaaga
gtgcatcttggtgttgcagttttgaggatccttgctttaggggtgaagaatgtgcaggag
tttgattttgttgatgctccaagtcaaagctccattgagatggctatccggaatctaatc
ctcttaggagtcattcaaatgaagaataatgttattgaattaacaaatgaaggtaggtac
ctggtaagaatggggatcgaacctaggcttggtaaactgattcttggctgtcttcatcat
acactgggtagagaaggcattgtccttgctgccttgatggctaatgctagcagcatattc
tgcagagttggtagtgaaaaggataagcaaagatctgattgtcttaaaatgcaattttgc
cattgtgatggcgacctctttacccttctttctgtgtacaaggaatgggagggtttgcct
cgggagaggaggaaccagtggtgttgggaaaatagtatcaatgccaaatctatgaggaga
tgccaagacacaattatagagctagaatcctgtcttgagcgtgaacttaaccttgttgtt
cccagttactggcgttggacaccccaaatgccctctgaatgtgatatgtatctgaaaagg
gttatactgtcctcccttcctgagaatgtagccatgtactctggatgcaagcaacttggt
tatgaagtggcacaaactggacaacatgttcagcttcatccatcttgttcattgcttgta
tttgctcagaaacctagttgggtggtttttagtgagcttctttcacattctaatcaatat
ttggtctgtgtaagtgcttttgattttgaatcattgcacagccttgaccctcctcccttg
ttcgatgtgtgcaatatggaaaagcggaaattggaaaccaggacattgtctggtttttgt
tgtactcttctcaagaaattttgtggaaaaggcaacggtaatttgattagtcttgtgtca
cgcatacggaaagtttgtgaggatgaacgaatttccattgaagttaatgttgaccacaat
gacattcagttatatgccacatcacatgatatggaaacagccgttcaatatgtaaatgag
gttttagaatgtgagaaaaagtggttacgtaccgagtgtattgaaaaatgtttgtatcat
gggtctggtttctcacctatagctttgtttggctctggtgcagaaattaagcatttagaa
cttgggaagcgttccctgagtgttgacgtttgtcacccaaacacagatgcaattgaagac
aaacagctcctgatgtttttggagaagaatacctcagcaagtgtctgttctgtccacaag
tacacatgcactgggagggatgttgatgacagggaaaagtggggcaggattacatttctt
tccccggatgctgctttaagagctgctgagctagatggtgaagagttttgtggctctcct
ttgaaaatttctcactcacaaacagcttctggagataaatcatttttgtttcctgccgtc
aaagcaaaaatcttttggcctcgtaggcttagcaagggggttgcgatagttaaatgtgac
ataaaggatgttgacatcatgttgagagatttctatagcctttctataggaggaaggtat
gtacggtgtgaacctggtagaaaggatgtggatagtgtggtgataagtgggtttgacaag
gagctctcagatgctgaaattttagatgtagtaagaaatgctacaagtataaggatttca
gactttttcttgattagaggagatgctgttgggaatccaccagtcagtgcctgtgaagag
gcgcttcttaaagaaatttcccccttcatgcccaagaaagatccccatattaactcttgt
cgggttcaagtcttccaacctgagcccagggatgtatccatgagagctttaatcacgttt
gatggaagactacatttagaggcagcaaaagctttagagcaaattgagggaaaggtgttg
ccaggatgtctttcatggcagaagataaaatgtcagcgcgtcttccatagctccttgata
gttcctctgccagtgtaccgtgtaattagggaagaattggagaaaatacttaaaagcttc
agtaatttaaagggtgttgaatgtagactggaaaagacttccaatggctcccagagattg
aaaattacagcaaatgccacacagacagtagcagaagttcggagacctttcgaagaatta
tcaagagggaaaagaatcgaccatgccagcctcacccctgcagttgtgcaactcttgctc
tctcgagagggctttaatctcaaaagctcattgcagcaggagacaggaacttacattctt
attgacaggtacaacctgagtgtacgtgtgtttgggcccccagacaaggtttgcttggct
cagcagaaactgattcaatccctactctctttccatgaggcaaagcaattggaaatccat
ctgaggggccgggatctacctcctgacttaatgaagcaggtggtgaagcaatttggacca
gatcttagtggattgaaagtgaaggtacctggggcagatcttgtactaaacatacgccgc
cagataatctatcttcgtggcaacaaggagttgaaacaaaaagtagaggagttcattttt
gagatcgtgcgttctagtcatcgtgctgttgagggattgggcaccggacctagttgccca
atttgcttgtgtgaggttgaggatggatatctgcttgaaggttgttgtcacttattctgc
cgttcatgcctggtggatcaatgcgaatctgctataagaaaccaaggtactttcccgata
tgttgtgctcgggagggctgtggagatcccattctggtcacagatttgaaggctctctta
ctgggtgacaagttggaggaacttttcagggcttctttgggatcttttgtggcatccagt
gggggaacatacagattttgcccgtcacctgactgcccctccgtttatcgagttgctgat
cctgggacagccggtgagccatttgtatgcggggcatgttattcagaaacttgtacaagg
tgccacttggagtatcatccgtacatatcatgcgatcaatatcgggaattcaaggacgac
cccgactcatcgctgaaggcatggtgcagcggtaaagaacatgttaagcggtgcccatct
tgtgggtatacaattgagaaggtagatggttgcaaccatattgagtgcaagtgtgggaag
catgtgtgctgggtttgcttggaattctttggaagtagtgataattgctatgaccatttg
agaaatatacacatggccatcatttga

DBGET integrated database retrieval system