KEGG   Arachis duranensis: 107470106Help
Entry
107470106         CDS       T04300                                 

Definition
(RefSeq) transcription elongation factor TFIIS
  KO
K03145  transcription elongation factor S-II
Organism
adu  Arachis duranensis
Brite
KEGG Orthology (KO) [BR:adu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:adu03021]
    107470106
Transcription machinery [BR:adu03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription elongation factors
     107470106
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TFIIS_M TFIIS_C Med26
Motif
Other DBs
NCBI-GeneID: 107470106
NCBI-ProteinID: XP_015944967
Position
A10
AA seq 357 aa AA seqDB search
MEKELIELYDAAKKAADAASCEDAGPHEESRCIDALNQLKKFPVNYKILVSTQVGKHLKH
ITKHPRQKIRAFAHDLIEIWKDIILTETGRIKNGGSDNKDSANGDRAKSGKMQKSPSVKV
EKVENGTSRPISAKVHHVDGKIEKNNGAANVKVEKIVKEEMQVSGTKKMSTSSPVTPKLK
TMIKSNDAMRDKIRDLLHEALSKVSGEAEEDMVDEVNACDPIRVAVKVESVLFEKWGPSN
GAQKVKYRSLMFNLKDQNNPDFRRKVLLGYIEPERLINMSTADMASEQRKKENEKIYEKA
LFECERGGPPKATTDQFKCGRCGQRKCTYYQMQTRSADEPMTTYVTCTVCSNRWKFC
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atggagaaggagctaatcgagctctacgatgcagccaagaaggccgccgatgccgccagc
tgcgaagacgccggccctcacgaagagtcccgatgtatcgatgccctcaatcagctcaag
aaattccccgtcaattacaagattctcgtcagcacccaggttggcaaacatcttaaacat
atcacaaagcatccaaggcagaaaattcgggcatttgctcatgacctaattgagatatgg
aaagacataatattaaccgaaacaggcagaataaagaatgggggctctgataacaaagac
tcggcaaatggtgatagagctaaatctggaaaaatgcagaagagtccttctgtgaaggtt
gagaaggttgaaaatggtacatcaaggccaatctcagcaaaggtacaccatgtggatggc
aaaattgaaaaaaataatggtgctgcaaatgtcaaggtggaaaagatagtcaaggaagag
atgcaagtttctggaacaaagaaaatgtcaacaagctcacctgttaccccaaagctgaag
actatgattaaatctaatgatgcgatgagagacaaaatacgggatcttctccatgaggct
ttatccaaggtttcaggagaggctgaggaggatatggtggatgaagtaaatgcctgtgat
cctattcgtgttgctgtgaaagtcgagtctgtgctctttgaaaagtggggcccttcaaat
ggtgcgcaaaaggtcaagtataggtccctgatgtttaacttgaaggatcaaaacaaccca
gattttcggagaaaagttctactcggctatattgagccagaacggttaatcaatatgagc
acggctgacatggctagtgagcagaggaagaaagagaacgagaagatctatgagaaggca
ttgtttgaatgtgaacgtggaggtccaccaaaagctacgacagatcaattcaagtgtggg
agatgtggtcaaaggaaatgcacctattaccaaatgcagactcgtagtgctgatgaacct
atgacaacttatgtcacttgtactgtctgcagcaaccgttggaagttctgttaa

DBGET integrated database retrieval system