KEGG   Arachis duranensis: 107474577Help
Entry
107474577         CDS       T04300                                 

Definition
(RefSeq) UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase
  KO
K01001  UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase [EC:2.7.8.15]
Organism
adu  Arachis duranensis
Pathway
adu00510  N-Glycan biosynthesis
adu01100  Metabolic pathways
Module
adu_M00055  N-glycan precursor biosynthesis
Brite
KEGG Orthology (KO) [BR:adu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    107474577
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:adu01003]
    107474577
Enzymes [BR:adu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.15  UDP-N-acetylglucosamine---dolichyl-phosphate N-acetylglucosaminephosphotransferase
     107474577
Glycosyltransferases [BR:adu01003]
 N-Glycan biosynthesis
  Dol-linked oligosaccharide
   107474577
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_4
Motif
Other DBs
NCBI-GeneID: 107474577
NCBI-ProteinID: XP_015949688
Position
A02
AA seq 438 aa AA seqDB search
MAPRKRISKTEPSSPEHPSSSSKGNNNVTTTVAAAPIPTHRKPPLQTNDPPIAPPKWGLI
LKLSLFSIPYAYLLFYHYKIEAELQRSVIINAGMSVAGFLVTVKLIPVASKYVLKRNLFG
FDINKKGTPQGNVKVPESLGIVVAIVYLVVAILFQYFNFTADSIWLVEYNAALACICFMT
LLGFVDDVLDVPWRVKLVLPSIAALPLLMAYAGHTTIVIPKPLVPHVEMEVLDLGWIYKL
YMGLLAVFCTNSINIHAGLNGLEVGQTVVIATAIVVHNIMQIGASSDPEYKQAHAFSIYL
AQPLLATSLGLLSYNWYPSSVFVGDTFTYFAGMTMAVVGILGHFSETLLIFFLPQVLNFL
MSLPQLFGFIPCPRHRLPRFDPQTGLLTGTKDGTLVNFFLRNLGRKSEKALCIYLLGFQA
IACCFCFLLRYFLAGWYK
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atggctccgcgaaagagaatctccaaaacagaaccttcgtcacccgaacacccttcttct
tcatcaaagggaaacaacaacgtcaccaccaccgttgccgccgccccaatccccacacac
cgcaagccaccactgcaaaccaatgaccctccaattgcgcctccaaaatggggtctcatt
ctgaaactctctctgttttctatcccttacgcgtatcttctcttctaccattacaaaatc
gaggccgagcttcaaagatccgtgatcatcaacgctgggatgagcgtcgcggggttcctt
gtgaccgttaaattgatccctgtcgcttccaaatacgttttgaagaggaatctatttggt
tttgatattaataagaagggtacccctcagggcaatgtcaaagtgcctgagtcattgggt
atagttgttgctattgtctacttagttgtggcaatcttatttcagtattttaacttcaca
gcagattcaatctggcttgttgagtacaatgcagcattggcttgcatttgtttcatgaca
ttgcttggatttgttgacgatgtccttgatgtcccatggagagtaaaattagtactcccg
tctattgctgcgctgcctttgttaatggcatacgctggacacacaacaatagttatacca
aagccacttgtcccacatgttgagatggaggttttggatcttggatggatatataaactg
tatatgggattgttggctgttttctgcacaaattccatcaatattcatgccggattaaat
ggccttgaagttgggcagacagtggttattgcaacagctattgtggtacacaatataatg
caaattggagcatcatcagatcctgaatataagcaagcacatgcattctctatatacctt
gctcagcccctgctagctacatctctgggtttactctcttataattggtatccttcttca
gtttttgttggtgacacattcacttacttcgctggaatgacaatggctgtggtcggtatt
ttaggccattttagtgaaacgcttttgattttcttcctgcctcaagttttgaactttctc
atgtcacttccccagcttttcgggtttattccatgtccacgccatagactgccaaggttt
gaccctcaaactggactattgactgggacaaaggatgggacactcgttaacttcttccta
agaaatcttggcaggaagtccgaaaaggcactttgcatttatcttcttgggttccaggct
attgcatgctgcttctgtttcttgctgaggtacttccttgctggttggtacaaatga

DBGET integrated database retrieval system