KEGG   Arachis duranensis: 107475764Help
Entry
107475764         CDS       T04300                                 

Definition
(RefSeq) probable glutathione peroxidase 5
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
adu  Arachis duranensis
Pathway
adu00480  Glutathione metabolism
adu00590  Arachidonic acid metabolism
adu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:adu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    107475764
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    107475764
Enzymes [BR:adu01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     107475764
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin YfkB AHJR-like
Motif
Other DBs
NCBI-GeneID: 107475764
NCBI-ProteinID: XP_020991585
Position
A02
AA seq 177 aa AA seqDB search
MGGSQSQQVTARSIHEFTVKDSKGREMNLKVFKGKVLLIVNVASKCALGNANYTQLTQLH
SRYKDKGFEILAFPCNQFLNKEPGTSQEAEAFACERYKATFPILGKVRVNGAETEPIYKF
LKSQKTGSMGSSRIKWNFTKFLVDEDGQVLRRYSPTTPPLALEMDIQKALGLVPKGF
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgggtggttcccaatcacaacaagtcacagcaagatcaatccatgaattcacagtgaag
gattccaagggcagagaaatgaacctgaaggtcttcaaaggaaaagttcttcttatagtt
aatgttgcatcaaaatgtgcattgggtaatgcaaattatacccagttaactcagcttcat
agtagatacaaggacaaaggttttgagatattggcatttccatgcaatcaatttttgaat
aaagagcctggaaccagtcaggaagctgaagcctttgcttgtgaaagatataaggctact
tttcccattttaggcaaggtgcgtgtgaatggagcagagacagaaccaatatataaattc
ttgaaatcacagaaaacaggaagcatgggatcatcaagaattaaatggaatttcacaaag
ttcttagttgatgaagatggccaagttctcaggcgttatagccctaccaccccaccactt
gcccttgaaatggacattcagaaggcattggggttggttccaaaaggtttctag

DBGET integrated database retrieval system