KEGG   Arachis duranensis: 107476225
Entry
107476225         CDS       T04300                                 

Definition
(RefSeq) delta(14)-sterol reductase isoform X1
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
adu  Arachis duranensis
Pathway
adu00100  Steroid biosynthesis
adu01100  Metabolic pathways
adu01110  Biosynthesis of secondary metabolites
Module
adu_M00917  Phytosterol biosynthesis, squalene 2,3-epoxide => campesterol/sitosterol
Brite
KEGG Orthology (KO) [BR:adu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    107476225
Enzymes [BR:adu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     107476225
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295
Other DBs
NCBI-GeneID: 107476225
NCBI-ProteinID: XP_015951483
UniProt: A0A6P4CH60
Position
A02
AA seq 369 aa
MDLGFLLQALIPSWNSAYLLLGFFAYLAIAGSIVPGKIVPGVVLADGTRLHYRCNGLVSL
LLLVALLGISAKMGFVSPTAISERGLELLSTTFIFSFLVTLALYFAGCKSRSKGSSLKPH
ITGNLIHDWWFGIQLNPQFMGIDLKFFFVRAGMMGWLLINLSVLAKSIQDGTLSKSMILF
QLFCALYILDYFVHEEYMTSTWDIIAERLGFMLVFGDLVWIPFTFSIQGWWLLANEVELT
PAAIIANCLVFLIGYMVFRGANKQKHVFKKNSKAPIWGKPPKVIGGKLLASGYWGIARHC
NYLGDLLLALSFSLPCGISSPVPYFYPIYLLILLIWRERRDESRCAEKYKEIWSEYEKLV
PWRILPYVY
NT seq 1110 nt   +upstreamnt  +downstreamnt
atggatctgggttttcttcttcaagctctcattccatcatggaactcagcttatttgctt
ctgggattctttgcttacttggccattgctggatccattgtgccgggaaaaattgttcct
ggggttgttcttgctgatggaactcgccttcattatcgttgcaatggtctggtctcgctt
cttctgttggttgcacttcttgggattagtgccaagatgggttttgtatctcctaccgct
atatctgagagaggacttgagctgctctccacaacatttatcttcagttttcttgtgacc
ctggcactttatttcgcgggttgcaagtcacgaagtaaaggttcatcactaaagcctcat
atcactggaaacctgatacatgattggtggtttggaattcaactgaatcctcagtttatg
ggtatcgacctcaaatttttctttgttagagctggaatgatggggtggctgcttatcaat
ttatccgttcttgcaaagagcattcaagatggtactttgagcaagtcaatgattctattc
cagctattctgtgcattatacatcttggactactttgtgcatgaagagtacatgacatca
acctgggacataattgcagagagattgggcttcatgttggtctttggagatttagtgtgg
attccttttacttttagcatacagggctggtggctcttggcgaacgaggtggagttaaca
ccggcagccattatagctaattgccttgtcttcctgattggatacatggtatttcgagga
gcaaacaaacaaaaacatgtattcaaaaagaattcaaaggctcctatttggggtaagcct
ccaaaagtcattggtggaaagttacttgcttctggttattggggtattgcaagacactgt
aattacttaggtgacttgcttcttgcactctcctttagcttaccttgtgggataagttca
ccagttccatacttctatccaatatatcttcttattttgttgatatggagagagagaagg
gatgaatctcgttgtgcagagaagtataaagagatttggagtgagtatgaaaaacttgtt
ccatggagaatattgccatatgtgtattag

DBGET integrated database retrieval system