KEGG   Arachis duranensis: 107477909Help
Entry
107477909         CDS       T04300                                 

Definition
(RefSeq) external alternative NAD(P)H-ubiquinone oxidoreductase B1, mitochondrial
  KO
K17871  NADH:ubiquinone reductase (non-electrogenic) [EC:1.6.5.9]
Organism
adu  Arachis duranensis
Brite
KEGG Orthology (KO) [BR:adu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    107477909
Enzymes [BR:adu01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.9  NADH:ubiquinone reductase (non-electrogenic)
     107477909
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_7 EF-hand_8
Motif
Other DBs
NCBI-GeneID: 107477909
NCBI-ProteinID: XP_015953489
Position
A03
AA seq 579 aa AA seqDB search
MKMGSFFMRASNALKGYPSSSKLLLLCTLSISGGGVVAYSESRSETEHPIIDAHVAPKKK
VVVLGTGWAGTSFLKDLDASRYDVQVVSPRNYFAFTPLLPSVTCGTVEARSIVEPVRTLI
KKNKGEIKYWEAECVKIDAANRKVFCKDNINNLVGRGEFSLDYDFLVLAVGSQVNTFNTP
GVKENCHFLKDIEDAKRIRLSITDCFEKAVLPSLSEEDRRSNLHFVVVGGGPTGVEFAAE
LHDYVQEDLTNLYPAVKDSVKITLIQSGDHILNTFDKRISTFAEQKFSRDGIEVQTGCRV
ISVSDKEITMKVKSTGEICSVPHGLIVWSTGISTIPVIRDFMEQVGQGKRRVLAIDEWLR
VKGCENVYAVGDCCTIDQRKIMDDISAIFAAADKNNSGTLTIEEFQDVMDDILLRYPQVE
LFMKKKHLLDFTSLWLDSQGNERKEIDIEGFKQALSHADSQMKSLPATAQVAAQQGTYLA
RCFNRMDQCEENPEGPRRFRGTGRHKFLPFRYKHFGQFAPLGGEQAAAELPGDWVSMGHS
TQWLWYSVYASKQVSWRTRVLVISDWTRRFIFGRDSSRV
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
atgaagatgggttccttcttcatgagggcctccaatgctctcaaaggctacccttcatcc
tccaagcttcttcttctctgcactctcagcatcagtggtggaggtgtagtggcatactca
gaatcacgatcagaaaccgaacatcctattattgatgctcatgtagcccccaaaaagaaa
gtagtggttcttggaacaggatgggctggtaccagtttccttaaggatctggatgcctca
cgatacgatgttcaggttgtttcgcctcggaactactttgcgttcactcccttgttaccc
agtgtcacttgtggaacagttgaagctcgaagcatcgtagagccagttcggaccttaata
aaaaagaataaaggtgaaataaaatattgggaggcagagtgtgtcaagattgatgctgca
aacagaaaggtcttttgtaaagacaatatcaacaacttagtgggaaggggcgaattttcg
ttggactacgacttcttggttttagcagtaggatcacaagtaaatacttttaacacccct
ggagtgaaagagaactgccactttctgaaggatatcgaggatgctaagaggatcaggctg
tctatcacagattgctttgagaaggctgttcttcctagtctatctgaagaagatcgaagg
tcgaatcttcattttgtagttgttggtgggggtccaactggagtagaatttgctgcagag
ctccatgattatgtccaagaagatttgacgaacttgtatccagccgttaaggattcagtg
aagataacattgattcaatcaggagatcacatcctgaatacgtttgataaaagaataagt
acatttgctgagcagaagttttcaagagacggtatagaggttcaaacaggatgtcgtgtc
atcagtgttagcgacaaggaaattacaatgaaggtgaaatcaacaggagagatttgctct
gtgccgcacggattgattgtctggtccactggcatttcaactattccagttataagggac
tttatggaacaagttggtcagggtaaaagacgtgtactagcaatcgacgaatggttgcga
gtaaaaggatgtgaaaatgtgtatgctgttggtgattgttgtacaatagatcaacgaaag
atcatggacgatatctcagccatatttgcggctgcagacaaaaataactccggtacctta
accattgaagaattccaagatgtgatggatgacatcttattaagatatccacaagttgaa
ctttttatgaagaaaaagcatcttcttgatttcacctctctgtggttagattcacaaggg
aatgaaagaaaagagatagacatagaagggtttaagcaggctctttctcatgcggattca
cagatgaagagtcttccagctactgcacaggttgctgcccaacaaggtacctatctagct
agatgctttaatcgcatggatcaatgtgaagagaatcctgaaggtcctcggcgatttaga
ggaaccggacgtcataagttccttcccttccggtataagcattttgggcaattcgcaccg
ctgggcggcgagcaagcagccgcagagcttcccggggactgggtttccatgggtcacagc
actcaatggctctggtattctgtatatgcaagcaagcaagtaagctggcgcacaagggta
ttggtcatatctgattggactagaagattcatttttggaagagactcaagtcgtgtttag

DBGET integrated database retrieval system