KEGG   Arachis duranensis: 107478240Help
Entry
107478240         CDS       T04300                                 

Definition
(RefSeq) (-)-germacrene D synthase-like
  KO
K15803  (-)-germacrene D synthase [EC:4.2.3.75]
Organism
adu  Arachis duranensis
Pathway
adu00909  Sesquiterpenoid and triterpenoid biosynthesis
Brite
KEGG Orthology (KO) [BR:adu00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00909 Sesquiterpenoid and triterpenoid biosynthesis
    107478240
Enzymes [BR:adu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.75  (-)-germacrene D synthase
     107478240
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Terpene_synth_C Terpene_synth DUF3368
Motif
Other DBs
NCBI-GeneID: 107478240
NCBI-ProteinID: XP_015953863
Position
A03
AA seq 568 aa AA seqDB search
MSTSGALTLNYYLPKPNANSSLHDHRRTSAYHPSIWKDYFLQYASEFKELDYKTEPQIDE
LKKEVSKMLTSTSEKPLAKLDLIDSICRLGIHYHFECEIDEVMQQIHKSYVKNGEITIED
NLRSIALFFRLLRQHGFRVSSNVFNKFKDIDGNFNESLTKDVEGMLSLYEASHLRIHREK
ILEEALKFTSTQLESIITTHHELSPFLAAQVKHSLRQPLHHGLPRWEARHYISIYQQHPN
QNEVLLTLAKLDFNHLQKLHKKEVGNLTKWWEELDVSRKLPYARDRIVECCSWILSVYFE
PKYYQARILLTQTIALLSIIDDTYDNYGTIDELELFTMAIDRWDACYLDDLPEYMKIIYR
ALLGAFEKAKQQVVKEGRGYSIDYGINEFKKTVKAYMTEAKWFKSNYVAKSEEYLQTCTR
STTYPLLTTTCFIGMGDMATEDVFKWVTNEPKIVTASAIVCRLMDDIVSNEFEQKRGHVA
SFLECYMKEYDVSREEAIKEAEKRVSDAWKDIHEECLMPTKVPMIFLIRSLNMTRFISVM
YKNQDNYTHAHGIMKKYIEDLLIDPVPI
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atgtctactagtggagctttaacccttaattattatctccccaagccaaatgcaaattct
agtttgcatgatcatcgacgcacttcagcatatcaccctagcatttggaaagactatttc
cttcaatatgcttcagaattcaaggaacttgattataaaactgagccacaaattgatgaa
ctgaagaaagaagtatccaaaatgcttacctcaacatctgagaagcccttagcaaaactt
gatttgattgattcaatatgtcgtttgggtatccattatcattttgaatgtgagattgat
gaagtgatgcaacagattcacaagagttatgtcaaaaatggagaaataactattgaagac
aatcttcgctccattgctttattctttaggttactgcggcagcatggatttcgggtttca
tctaatgtgttcaacaaatttaaggatatagatggaaattttaatgaaagccttacgaaa
gatgttgaaggaatgctaagtttatatgaagcttcacacctaagaattcatagagagaag
atattagaagaagctcttaaattcacttccactcagcttgagtccattattactacccat
catgagttgagcccttttcttgcagcgcaagttaagcatagtttaaggcagcctctccac
catggcttgccaaggtgggaggcaagacattatatttcaatctaccaacaacatcccaat
caaaatgaagttttactcactcttgctaaattggatttcaatcatctacaaaagttgcat
aaaaaagaagttggcaacctcaccaagtggtgggaggagttagatgtgagtagaaaacta
ccatatgcacgggataggattgtggaatgttgcagttggattttgtctgtatattttgag
cccaaatattatcaagcaagaatattactaacacaaacaatcgccttgttatcaatcatt
gatgacacatatgataattatggaaccattgatgaattggaactttttactatggcaatt
gacaggtgggatgcttgctacttggatgatctacccgaatatatgaaaataatttacagg
gctctcttaggagcttttgaaaaagccaaacaacaagtggtgaaggaaggaagaggatat
agcattgactatggcataaatgaatttaagaaaacagtgaaagcttacatgactgaagcc
aaatggttcaagagtaactatgttgcaaaatcagaggagtatctccagacatgtactcga
tcaaccacttacccattactcacaactacttgttttattggcatgggagacatggctacc
gaggacgtcttcaaatgggtcactaatgaacccaaaattgttacagcttctgcaattgtt
tgcaggctcatggatgatatcgtctccaatgagtttgaacagaaaagaggacatgttgcc
tcatttctagagtgctatatgaaggaatatgacgtgtcaagagaagaagccattaaagaa
gcagagaagagagttagtgatgcttggaaggatatacatgaagaatgtcttatgccaacc
aaagttccaatgatatttctcatccgctctctcaacatgacacgatttataagcgtcatg
tacaaaaatcaagataattacactcatgcccatggaataatgaagaaatacattgaggat
ttgcttatagatcctgttccaatataa

DBGET integrated database retrieval system