KEGG   Arachis duranensis: 107479955Help
Entry
107479955         CDS       T04300                                 

Definition
(RefSeq) probable phospholipid hydroperoxide glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
adu  Arachis duranensis
Pathway
adu00480  Glutathione metabolism
adu00590  Arachidonic acid metabolism
adu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:adu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    107479955
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    107479955
Enzymes [BR:adu01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     107479955
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin DUF5643
Motif
Other DBs
NCBI-GeneID: 107479955
NCBI-ProteinID: XP_015955555
Position
A03
AA seq 241 aa AA seqDB search
MLCSSTRILFGRGIRRVVPPLSSSINYLINPKAKTLSLSRPYQRHHHISFFKSIPTLTPT
PTPLRFSLKTDHTMASQSSPPKSVHDFTVKDARGNDVNLGNYKGKVLLIVNVASQCGLTN
SNYTELSQLYEKYRAKGLEILAFPCNQFGAQEPGTNEQIVEFACTRFKAEYPIFDKVDVN
GNDAAPLYKYLKSSKGGLFGDNIKWNFSKFLVDKEGNVVDRYAPTTSPLSIEKDIKKLLD
A
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgctttgtagttcaactcgtatcttgttcggcagaggcataaggagagtggttccaccc
ctttcttcttctattaactatttgatcaatcctaaagccaaaaccctttcactctctcgg
ccttatcagcggcatcatcatatctcgttcttcaaatcaatcccaactctaactccaact
ccaactccgttgcgatttagtttgaaaacagatcacaccatggccagccaatcatctcct
cccaaatcagtccacgatttcaccgttaaggatgcgaggggaaatgatgttaatcttgga
aactacaaagggaaggttcttctcattgtcaacgttgcctcacaatgtggcttgaccaat
tctaattatacagagctgagtcaattgtacgaaaaatacagggcgaaaggtcttgaaatc
ctggcatttccttgcaatcagtttggggcacaggagcctggaactaatgagcagatagta
gaatttgcttgcactcgcttcaaagctgagtatcccatttttgacaaggtggatgtgaat
ggtaacgatgctgctccactgtataagtatcttaaatcaagcaaaggtggactctttggg
gacaacataaaatggaacttctccaaattccttgttgacaaagagggcaatgttgtggat
cgttatgcacccactacttctcctctaagcatcgagaaggacataaagaagctgttggat
gcgtga

DBGET integrated database retrieval system