KEGG   Arachis duranensis: 107480630Help
Entry
107480630         CDS       T04300                                 

Definition
(RefSeq) external alternative NAD(P)H-ubiquinone oxidoreductase B2, mitochondrial
  KO
K17871  NADH:ubiquinone reductase (non-electrogenic) [EC:1.6.5.9]
Organism
adu  Arachis duranensis
Brite
KEGG Orthology (KO) [BR:adu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    107480630
Enzymes [BR:adu01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.9  NADH:ubiquinone reductase (non-electrogenic)
     107480630
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_7 EF-hand_8 p25-alpha LysR_substrate EF-hand_10 AAA_assoc NAD_binding_7 DUF4363
Motif
Other DBs
NCBI-GeneID: 107480630
NCBI-ProteinID: XP_015956271
Position
A03
AA seq 580 aa AA seqDB search
MRTFTFFQRLSKAFHGYDSHFKLVLLCTTVSGGGLLAYGEAVAQSEAAVVKEEKKKVVVL
GTGWAGTSFLKNLENPRYEVHVVSPRNYFAFTPLLPSVTCGTVEARSIVEPVRNIFRKKN
VKVDFSEAECLKIDAANRKVYCRSSISNNSNEKDEFVVDYDFLIIAVGANVNTFNTPGVV
ENCHFLKEVEDAQKIRRTVIDCFERASLPSVSEEEKKRILHFAIVGGGPTGVEFAASLHD
FVNEDLVKLYPGIKDLVKITLLEAGEHILSMFDKRITSFAEDKFRRDGIDVKTGSMVVKV
SDKEISTKEMKNGGEITTMPYGMAVWSTGIGTRPFIRDFMTQIGQINRRAVATDEWLRVE
GTNNVYALGDCATINQRKVMEDIAAIFKKADKDNSGTLTVKEFQEVLDDICERYPQVELY
LKTRQMNDIADLLKEAKGDVAKESIELSIEELKTALSKVDSQMKFLPATAQVASQQGTYL
AKCFNRMEECEKNPEGPIRFRGEGRHRFKPFRYKHLGQFAPLGGEQAAAQLPGDWVSIGH
STQWLWYSVYASKQVSWRTRALVVSDWTRRFIFGRDSSQI
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atgcgcactttcactttcttccagcgtctttctaaagctttccatggctacgactcccac
ttcaagcttgtactcctctgcaccaccgttagcggtggtggacttttggcatacggcgag
gcggtagctcaatcggaagcggcggtagtgaaggaggagaagaagaaggtggtggtgctg
gggacaggttgggcagggacgagcttcttgaagaatctggagaatcccagatatgaggtc
cacgtggtgtctcctcgcaactattttgccttcacacctttgcttcctagtgtcacgtgc
ggcaccgtcgaggcccgtagcatcgttgaacccgttcgcaacatctttaggaagaaaaat
gtgaaagtagacttcagtgaagcagaatgtctcaagattgacgcagcaaacaggaaagtt
tactgtcgatcaagtataagcaataattcgaatgaaaaagatgaatttgttgtggactat
gacttcctcatcatagccgtgggagcaaatgtaaacacattcaatactcccggggtggtg
gagaattgccatttcttgaaggaagttgaagatgcacagaagatcagaagaacagttatt
gactgctttgagagagcaagcttgcctagtgtaagtgaggaagagaagaagagaatcctt
cattttgctattgttggaggtggtccgaccggggtggagtttgcagcctctcttcatgac
ttcgtcaatgaagatttggtcaaattatatcccggtataaaagatttggttaagattacg
cttctggaggcaggggaacatattttgagcatgtttgacaaaagaatcacttcttttgct
gaggacaagttccgaagagatggcatcgatgtgaaaactggatccatggttgtgaaggta
tctgataaagaaatttcgactaaagaaatgaaaaatggaggagaaatcactacaatgcca
tatggaatggctgtctggtcaactggcattggaactcgtccatttattagagattttatg
acacaaattggccagattaacaggcgtgctgttgctaccgatgaatggttgagagttgag
ggaaccaacaatgtgtatgcacttggagattgtgctacaataaaccagcgaaaagtcatg
gaagatattgcagcaatctttaagaaggcggacaaagacaactcaggaaccctcacggtc
aaagaatttcaagaggtattggatgatatctgtgagagataccctcaggtagaactgtat
ctgaagactagacaaatgaatgatattgctgatctgttgaaagaagccaagggagatgtt
gcaaaggaatctattgagctgagtatcgaagaactaaaaactgcactttctaaagtggat
tctcaaatgaagtttcttcctgctacagcacaggttgcatctcagcaaggcacctacctt
gccaagtgctttaatcggatggaggagtgtgaaaagaatcctgagggtcctatcaggttc
aggggagaaggacgccataggttcaaacccttcaggtacaagcatttaggtcaatttgct
cctctgggaggagagcaggcagctgcacagcttcctggtgattgggtttcaattggtcat
agcactcaatggctttggtattctgtctatgcaagcaagcaagttagctggcgcacacgg
gcattagttgtatcagactggacaaggcgttttatttttggaagggactcaagtcaaatc
tga

DBGET integrated database retrieval system