KEGG   Arachis duranensis: 107484068Help
Entry
107484068         CDS       T04300                                 

Definition
(RefSeq) FK506-binding protein 2
  KO
K09569  FK506-binding protein 2 [EC:5.2.1.8]
Organism
adu  Arachis duranensis
Brite
KEGG Orthology (KO) [BR:adu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:adu03110]
    107484068
Enzymes [BR:adu01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     107484068
Chaperones and folding catalysts [BR:adu03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   FKBP
    107484068
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FKBP_C
Motif
Other DBs
NCBI-GeneID: 107484068
NCBI-ProteinID: XP_015960166
Position
A04
AA seq 147 aa AA seqDB search
MKATLLLLLYFFLVSLLVYAKKSGDVTALQIGVKHKPASCDVQAHKGDRVKVHYRGKLTD
GTVFDSSFERDNPIEFELGTGQVIKGWDQGLLGMCLGEKRKLKIPASLGYGEQGSPPTIP
GGATLIFDTELVGVNGKTLGGAEESEL
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcaacactgcttcttcttctatacttctttctcgtttctttgctagtttatgca
aagaaatccggcgacgttacagctttgcagatcggcgtgaagcacaagccagcgtcatgt
gatgtccaagcacacaaaggagatagagtcaaagtacattatcgggggaaactcactgat
ggaacagtttttgattctagctttgaaagggataatccaattgaatttgagcttggtact
ggtcaagtgatcaaaggttgggatcaaggattattgggaatgtgcctgggtgagaagcgg
aaattaaaaatacctgctagtcttggttatggagagcaaggttctccgccaaccatccca
ggtggagcaactcttatatttgacactgagcttgtgggggtgaatggaaaaactttgggc
ggagcagaggagtccgagctctag

DBGET integrated database retrieval system