KEGG   Arachis duranensis: 107485675Help
Entry
107485675         CDS       T04300                                 

Definition
(RefSeq) DEAD-box ATP-dependent RNA helicase 50 isoform X1
  KO
K13179  ATP-dependent RNA helicase DDX18/HAS1 [EC:3.6.4.13]
Organism
adu  Arachis duranensis
Brite
KEGG Orthology (KO) [BR:adu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:adu03041]
    107485675
   03009 Ribosome biogenesis [BR:adu03009]
    107485675
Enzymes [BR:adu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     107485675
Spliceosome [BR:adu03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   RNA helicase-like proteins
    107485675
Ribosome biogenesis [BR:adu03009]
 Eukaryotic type
  90S particles
   Helicases
    107485675
  Pre-60S particles
    107485675
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DEAD Helicase_C ResIII SNF2_N CMS1 AAA_30 NACHT
Motif
Other DBs
NCBI-GeneID: 107485675
NCBI-ProteinID: XP_020996549
Position
A04
AA seq 548 aa AA seqDB search
MTGSVLATLVPSSNCNSRPWWWDWPSLSQRPSLISPWRTTPSITTTATVFSSSQQQDIGI
ITSIDSSSSSISPSFERLKTQKVKALVHSSKQHRNRSTDDGRPRDSSPKPNPRSRGGWGD
AGGSFRSLHSQELAPDTSFFSVKSFRELGCADYLIQSLQKLSFPRPSNVQAMAFAPVIAG
KTCIIADQSGSGKTLAYLAPIIQRLRQEELEGHSKSSPQAPRVVILAPTAELASQVLDNC
RSLSRSGVPFKSMVVTGGFRQRTQLETLQQGVDVLIATPGRFLFLMKEGFLQLTNLRCVV
LDEVDILFGDEDFEVALQSLINSSPITTQYLFVTATLPRDVYSKLVEIFPDCEMIMGPSM
HRISPRLEEIIVDCSGEDGQEKTTDTAFLNKKSALLQLAEERPVPRTIVFCNKIETCRKV
ENALKRIDRKGAVIQVLPFHAAMTQESRLASMKEFARSPSKQVSQFMVCTDRASRGIDFW
GVEHVILFDFPRDPSEYVRRVGRTARGAKGVGKAFIFVVGKQVSLARKIMERNRKGHPLH
DVPSAVTF
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atgaccggttctgttcttgcaaccttggttcccagttccaattgcaattccagaccgtgg
tggtgggactggccatcactctctcaaaggccgtcactgatttctccttggcgcactact
ccctccatcaccaccacagccaccgtcttctcctcctctcagcaacaagacatcggcatc
ataacaagcattgattcgtcctcatcctcaataagcccgagtttcgaaagactgaaaact
cagaaagtcaaagctctcgtccacagttctaagcagcacagaaacagaagcactgacgat
ggtcgaccacgtgattcatcgccaaagccaaaccctcgttcaagaggaggatggggggat
gctggaggatccttccgttctcttcattctcaggagctcgctcccgacaccagcttcttc
agtgtcaagtccttcagggaactaggctgcgctgactacctcatccaatcactccaaaag
ctctctttcccgcgcccttccaatgtacaggccatggcatttgcacctgttattgctgga
aagacttgtattatagctgaccaaagtggttctggaaagactttagcatatcttgcacca
ataattcagcgtcttaggcaagaagaactagaaggacacagtaaatcctctcctcaagct
cctagagttgtcatactagcaccaacagctgaattagcttcccaggtcttagataattgt
cgatcactgtctagatctggggttccatttaaatctatggttgtcacaggtggctttcga
caaagaactcaactggaaactttacaacagggtgttgatgtattaatagctacacctggc
cgttttttgttccttatgaaggagggcttcttgcagttaacaaatctaagatgtgttgtt
ttggatgaggtagatattctctttggtgatgaggatttcgaagtggctcttcaaagcttg
atcaattcctcacccataactacacaatacttatttgtgactgcaactctaccaagagat
gtttacagcaaactggttgaaattttccccgattgtgaaatgatcatgggacctagtatg
caccgaataagcccacgccttgaagagatcatagtagattgcagtggagaagatgggcaa
gaaaaaactactgatacagcatttctgaacaagaaatctgctcttctgcagcttgcagag
gaacgccctgttccaagaactattgtgttttgcaacaaaattgaaacatgcagaaaagtt
gagaatgcattaaagcgtatagatagaaagggagcagttatacaagttctacctttccat
gctgccatgacacaagaatcaaggcttgcaagtatgaaggagtttgcacgttcaccgtca
aaacaagtgtcccagtttatggtttgcacggaccgagcatcaaggggaatagacttttgg
ggagtggagcacgtgatactgttcgacttcccgagggatccaagcgaatatgtgaggcgt
gtcggaagaacggcgagaggtgccaagggtgtggggaaggcattcatattcgtggtaggc
aagcaagtatcgcttgcacgcaaaatcatggaaagaaataggaagggtcaccccttacat
gatgtcccttctgctgttaccttctag

DBGET integrated database retrieval system