KEGG   Arachis duranensis: 107491681Help
Entry
107491681         CDS       T04300                                 

Definition
(RefSeq) probable mediator of RNA polymerase II transcription subunit 37c
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
adu  Arachis duranensis
Pathway
adu03040  Spliceosome
adu04141  Protein processing in endoplasmic reticulum
adu04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:adu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    107491681
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107491681
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107491681
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:adu01009]
    107491681
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:adu03041]
    107491681
   03009 Ribosome biogenesis [BR:adu03009]
    107491681
   03110 Chaperones and folding catalysts [BR:adu03110]
    107491681
   04131 Membrane trafficking [BR:adu04131]
    107491681
   03051 Proteasome [BR:adu03051]
    107491681
   03029 Mitochondrial biogenesis [BR:adu03029]
    107491681
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:adu04147]
    107491681
Protein phosphatases and associated proteins [BR:adu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     107491681
Spliceosome [BR:adu03041]
 Complex B
  Other components
   Prp19 complex
    107491681
 Complex C
   Prp19-CDC5 complex
    107491681
Ribosome biogenesis [BR:adu03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    107491681
Chaperones and folding catalysts [BR:adu03110]
 Heat shock proteins
  HSP70 / DNAK
   107491681
Membrane trafficking [BR:adu04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    107491681
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    107491681
Proteasome [BR:adu03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    107491681
Mitochondrial biogenesis [BR:adu03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    107491681
Exosome [BR:adu04147]
 Exosomal proteins
  Proteins found in most exosomes
   107491681
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl DDR FGGY_C Hydantoinase_A
Motif
Other DBs
NCBI-GeneID: 107491681
NCBI-ProteinID: XP_015968060
Position
A06
AA seq 651 aa AA seqDB search
MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
QVAMNPINTVFDAKRLIGRRFSDPSVQSDIKLWPFKVISGPAEKPMIVVNYKGEEKQFAA
EEISSMVLMKMREIAEAYLGSSVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD
NRMVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGIDFY
SPITRARFEELNMDLFRKCMEPVEKCLRDAKMDKRSVHDVVLVGGSTRIPKVQQLLQDFF
NGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLI
PRNTTIPTKKEQVFSTYSDNQPGVLIQVFEGERTRTRDNNLLGKFELSGIPPAPRGVPQI
TVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEDIEKMVQEAEKYKSEDEEHKK
KVEAKNALENYAYNMRNTVKDDKIGGKLDPADKKKIEDAIEQSIQWLDSNQLAEADEFED
KMKELEGICNPIIAKMYQGGAGPDVGGAGAGDDDYAPSGGSGAGPKIEEVD
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
atggccggaaaaggagagggaccagccatcggaatcgatctcggaaccacgtactcgtgc
gtcggagtttggcagcatgaccgtgttgagatcatcgccaacgaccaaggaaacagaacg
acgccgtcctacgtcgcattcactgacaccgagcgtctcataggcgatgccgccaagaac
caggtcgccatgaaccctatcaacactgtcttcgatgccaagaggttgattggtcgcaga
tttagcgatccctctgtgcagagtgatattaagttgtggccatttaaggttatttctgga
cctgctgagaagcccatgattgtggttaactacaagggtgaagagaagcaatttgccgca
gaagagatctcttctatggtactcatgaagatgcgtgagattgcagaggcctatcttggc
tcttcagtgaagaacgctgttgttactgtccctgcttacttcaatgattctcagcgtcag
gcaaccaaggatgctggtgttattgctggtcttaatgtcatgagaattatcaatgagcct
actgctgctgccattgcatatggtcttgacaagaaggcaacaagcgttggtgagaagaat
gtcttgatttttgatcttggtggaggtacttttgacgtatccttgcttactattgaggaa
ggtatctttgaggtgaaggctacagctggagacacccatcttgggggcgaagattttgat
aacagaatggtgaaccactttgttcaggagtttaagagaaagaacaagaaggacataagt
ggcaaccctagagctcttaggaggttgaggacagcttgtgagagagcaaagaggacactt
tcatctactgcccagaccaccattgaaattgattcgctgtatgagggaattgatttctat
tctccaattactcgtgcaagatttgaggagctcaatatggatcttttcaggaagtgtatg
gagccagttgagaaatgtttgagagatgctaaaatggacaaaagaagtgtccatgatgtt
gtccttgttggcggttcaactagaattcccaaggttcaacaacttttgcaagatttcttc
aatggaaaggaattgtgcaagagcattaatcctgatgaggctgttgcctatggtgctgca
gttcaggctgccatcttgagtggtgagggcaatgaaaaggttcaggacctactccttctt
gatgtcacccctctgtcacttggtttggagactgctggtggtgtgatgaccgtcctgatc
ccaaggaacactacaattccaacaaagaaggaacaagttttctcaacatattcggacaac
cagcctggtgtgttgatccaggtcttcgagggtgagagaacaaggacaagggataacaat
ttgttgggcaaatttgaactttcaggcattcctcctgctcccaggggtgttccacagatc
actgtgtgttttgacattgatgccaatggtatcttgaatgtgtctgcggaagacaaaact
actggccagaagaataagatcaccatcaccaatgacaagggaagactttcaaaggaagat
atagagaagatggttcaagaggccgagaagtacaagtctgaggatgaagagcataaaaag
aaggttgaagccaagaatgctttggaaaactatgcatacaacatgaggaacactgtgaag
gatgacaagattggaggaaaacttgacccagctgacaagaagaagattgaggatgccatt
gagcaatctattcagtggctagacagcaaccagcttgccgaagcagatgagtttgaggat
aagatgaaggaactggaaggcatctgcaatccaatcattgccaagatgtaccaaggtggt
gctggtcctgatgttggtggagctggtgcaggcgatgatgactatgctccctctggtgga
agtggtgctggccctaagattgaggaagtcgactaa

DBGET integrated database retrieval system