KEGG   Arachis duranensis: 107491713Help
Entry
107491713         CDS       T04300                                 

Definition
(RefSeq) tyrosine decarboxylase 1
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
adu  Arachis duranensis
Pathway
adu00350  Tyrosine metabolism
adu00360  Phenylalanine metabolism
adu00380  Tryptophan metabolism
adu00950  Isoquinoline alkaloid biosynthesis
adu00965  Betalain biosynthesis
adu01100  Metabolic pathways
adu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:adu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    107491713
   00360 Phenylalanine metabolism
    107491713
   00380 Tryptophan metabolism
    107491713
  09110 Biosynthesis of other secondary metabolites
   00901 Indole alkaloid biosynthesis
    107491713
   00950 Isoquinoline alkaloid biosynthesis
    107491713
   00965 Betalain biosynthesis
    107491713
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:adu04147]
    107491713
Enzymes [BR:adu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     107491713
    4.1.1.105  L-tryptophan decarboxylase
     107491713
Exosome [BR:adu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   107491713
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 107491713
NCBI-ProteinID: XP_015968107
Position
A06
AA seq 479 aa AA seqDB search
MDAEQLREHAHKMVDFIADYYKTIESFPVLSQVQPGYLEKLLPDSAPDYPETLEHVLNDV
QEKILPGVTHWQSPNYFAYFPSNSSIAGFLGEMLSAGFNIVGFSWITSPAATELETIVLD
WLAKALKLPHDFHSTGQGGGVIQGTASEAVLVVLLAARDKILRTVGKDALPKLVTYASDQ
THSSLLKACQIGGLNPELCRSLKTDASTNYALSPEVFSEAVSRDIASGLIPFFLCATVGT
TSSTAIDPLPELGKIAKFKNIWFHVDAAYAGSACVCPEYRHHLNGVEEADSFNMNAHKWL
LTNFDCSLLWVKDRSALIQSLSTNPEYLKNKASQGNMVIDYKDWQIPLGRRFRSLKLWMV
MRLYGLEGLRNHTRNHINLAAYFEDLVGQDSRFKVVTPRTFSLVCFRLLPPANTEDTNKL
NRDLLDSVNSTGSVFITHTVLSGQFILRFAVGAPLTEQRHVDTAWRILQEKATALLGSL
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atggacgcggagcaactcagagagcatgcacataagatggttgattttattgctgactac
tacaaaaccattgagagtttcccagttctcagccaagttcagccaggttatcttgaaaag
ctcttaccggattctgctcctgattatcctgaaacactggagcatgttttgaatgatgta
caggaaaagattttgccaggggtaacacattggcaaagccccaattattttgcatatttt
ccttccaacagtagcattgctggatttcttggagaaatgctcagtgctggtttcaacatt
gttggtttcagctggataacttctccggccgcaacagaactcgaaaccattgttctcgat
tggcttgctaaggcacttaagctgcctcatgatttccattctactgggcaaggtggtgga
gttattcaaggaacagcgagtgaagcagtactagttgtcttgttggctgctcgcgacaag
atcttaaggacggttggaaaagacgctcttcctaagctcgtgacatacgcatctgatcaa
acacactcttctctactaaaagcctgccagataggtggacttaatcctgagctttgcagg
tcactaaaaactgatgcttcaacaaattatgcgctttctcctgaagtattttctgaagca
gtttcaagggacattgctagtggtcttataccatttttcttatgtgctactgttggtaca
acttcatcaactgctattgatcctctacctgaattggggaaaattgctaagttcaaaaac
atttggtttcatgttgatgctgcttatgctggaagtgcttgtgtatgtccagagtatcga
caccatctcaatggtgtcgaagaagcagactcattcaacatgaatgcgcataaatggctc
ttgacaaactttgactgttcactactttgggttaaggatagaagtgctctgattcaatca
ctatctacaaacccggagtatctgaaaaacaaggcctctcaaggaaatatggtcatagat
tacaaagattggcaaattcccctggggcgtcgctttagatcgttaaaactgtggatggtg
atgcgtctctacggattggaaggtctgcgaaatcacacgaggaaccacattaatctggct
gcttattttgaggaccttgttggtcaggattcaaggttcaaggttgttacgcctcgcacg
ttctctttagtctgctttcggcttttgcctccggctaacacagaagatactaataaactg
aaccgtgatctacttgactcggtgaattcaacaggaagtgttttcataacacacacggtt
ctatcaggtcagttcattctgcgttttgcagtaggagcaccattgacagaacagaggcac
gtcgacacagcatggcgaattttgcaagaaaaggccactgctttgcttggcagtttgtag

DBGET integrated database retrieval system